DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and tbc1d25

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001121708.1 Gene:tbc1d25 / 556338 ZFINID:ZDB-GENE-041111-25 Length:863 Species:Danio rerio


Alignment Length:263 Identity:88/263 - (33%)
Similarity:142/263 - (53%) Gaps:22/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 RPEVKKSEMHPDEGDVKKITTNFFYGTLLNEKGQIEDDLLLRKCVFFGGLEKSLRKTVWPFLLKC 404
            :|.:..:|.|           |:     ||.:||:.....||..::.||:|.||||.||.:||..
Zfish   169 KPPLSDAEFH-----------NY-----LNSQGQLSRPEELRLRIYHGGVESSLRKVVWRYLLNV 217

  Fly   405 YSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQIHFWKTVQIVVEKDVVRTDRTNPFFCG- 468
            |....|.::|...|..|.:||:::..:....:|.| ::.|   ::..|.|||:||||.:|::.| 
Zfish   218 YPDGLTGQERMDYMKRKTREYDQLKSEWTARVSSE-ELEF---IRGNVLKDVLRTDRAHPYYAGS 278

  Fly   469 DDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWCFVGLMQRAFFVCTPTD 533
            :|:|:...:.::|..||:.:..:||.|||||:.:|:|..:.||:..|.||.|:|:|......|..
Zfish   279 EDSPHLTALTDLLTTFAITHPQVSYCQGMSDIASPILAVMDNEAHAFICFCGIMKRLEGNFRPDG 343

  Fly   534 RDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEACWSNY 598
            :.:.....:|:.|::...|.||.:|.. ..:.:|.||:|||||..||||.....:||.|..||:.
Zfish   344 QLMSIKFQHLKLLLQYSDPEFYSYLVS-KGADDLFFCYRWLLLELKREFAFDDALRMLEVTWSSL 407

  Fly   599 LTD 601
            ..|
Zfish   408 PPD 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 78/216 (36%)
tbc1d25NP_001121708.1 TBC 198..420 CDD:214540 78/218 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.