DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and TBC1D8B

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_060222.2 Gene:TBC1D8B / 54885 HGNCID:24715 Length:1120 Species:Homo sapiens


Alignment Length:647 Identity:122/647 - (18%)
Similarity:191/647 - (29%) Gaps:261/647 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SFILGDERLDRKIDIAYED--------NEILFCKNNVC-----------IH------------PP 45
            ||:||.|   .|:.|::::        |.||....:||           :|            ..
Human   189 SFLLGSE---IKLIISWDEVSKLEKTSNVILTESIHVCSQGENHYFSMFLHINQTYLLMEQLANY 250

  Fly    46 TIAR-------DESDILHNPGYLT---CTTKTFVDQYN---------SAKRPTLLLTWIPNSSLC 91
            .|.|       |...:|:||..:|   ...:...:|:|         |.|.......|:|.|   
Human   251 AIRRLFDKETFDNDPVLYNPLQITKRGLENRAHSEQFNAFFRLPKGESLKEVHECFLWVPFS--- 312

  Fly    92 KYTNLNADDCRGQCNPRSKSPDSRNGYCHVTIPQTIQERDIREEDE------------------- 137
             :.|.:...|..:......|.|...  |.|.||.    |::...|:                   
Human   313 -HFNTHGKMCISENYICFASQDGNQ--CSVIIPL----REVLAIDKTNDSSKSVIISIKGKTAFR 370

  Fly   138 --NAADMQELKNELQPLLGGQAASIDDLTALLKNNPITSVNITISNPQIENSNISQSFNCITIRP 200
              ...|.::|..:|:...|..:....|:          |..:.||:   |::..|.:|...:: .
Human   371 FHEVKDFEQLVAKLRLRCGAASTQYHDI----------STELAISS---ESTEPSDNFEVQSL-T 421

  Fly   201 DSNNCSDCTNGSGVGDGPATDNPKWTTPELLAFKH--NLEFPDSGNSTPADRQKSAMKCRHFSVD 263
            ....||...|                |..|:...|  |||..:|      ...|..||       
Human   422 SQRECSKTVN----------------TEALMTVFHPQNLETLNS------KMLKEKMK------- 457

  Fly   264 LSQMRSLRLFFNDDNCTSGQLVIASRESQYKILHFHYGGLDHLAQVLHQWHCFLHNITSETGQDK 328
                                      |..:|||....|                      .|...
Human   458 --------------------------EQSWKILFAECG----------------------RGVSM 474

  Fly   329 FDLPYRHFMVCRPEVKKSEMHPDEGDVKKITTNFFYGTLLNEKGQIEDDLLLRKCVFFGGLEKSL 393
            |            ..||:.                             ||::|      |:.::|
Human   475 F------------RTKKTR-----------------------------DLVVR------GIPETL 492

  Fly   394 RKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRL--YSMSPEQQIHFWKTVQIVVEKDV 456
            |..:|..      ||....|.|...|.    |.|:..:.|  .:::.|:           :|:|:
Human   493 RGELWML------FSGAVNDMATNPDY----YTEVVEQSLGTCNLATEE-----------IERDL 536

  Fly   457 VRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWCFVGL 521
            .|:...:|.|..|  .....::.:|..:|..|..:.|.|.| ::|..||.....|.|.||..|.:
Human   537 RRSLPEHPAFQSD--TGISALRRVLTAYAYRNPKIGYCQAM-NILTSVLLLYAKEEEAFWLLVAV 598

  Fly   522 MQRA---FFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHN--DSMELLFCHRWLLLCF 578
            .:|.   :|........||.  :...||||..||...:|:....  .|:.|    .|.|..|
Human   599 CERMLPDYFNRRIIGALVDQ--AVFEELIRDHLPQLTEHMTDMTFFSSVSL----SWFLTLF 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 49/199 (25%)
TBC1D8BNP_060222.2 PH-GRAM1_TBC1D8B 156..254 CDD:275419 14/67 (21%)
PH-GRAM2_TBC1D8B 296..388 CDD:270159 18/101 (18%)
TBC 486..694 CDD:214540 50/205 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1035..1066
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.