DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and Tbc1d5

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_008764990.1 Gene:Tbc1d5 / 501088 RGDID:1561626 Length:827 Species:Rattus norvegicus


Alignment Length:249 Identity:53/249 - (21%)
Similarity:101/249 - (40%) Gaps:71/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 KTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVL----C 506
            |.::.::|:||.||.....|| ..:|.. :::.::|..:|..|..:.|.|||.:||||::    |
  Rat   157 KELRSMIEQDVRRTFPEMQFF-QQENVR-KILTDVLFCYARENEQLLYKQGMHELLAPIIFTLHC 219

  Fly   507 EVQN-----------------------ESETFWCFVGLMQRAFFVCTPTDRDVDHNLSYLRELIR 548
            :.|.                       |.:.:..|..||:.|    .|.....:|:....:|.:.
  Rat   220 DHQAFLHASESAQPSEEMKTLLNPEYLEHDAYAMFSQLMETA----EPWFSTFEHDGQKGKETLM 280

  Fly   549 IMLP----------------------HFYK----HLEQHNDSMEL---LFCHRWLLLCFKREFTE 584
            ..:|                      |..|    .|..|.:.:|:   ::..||:.|.|.|||..
  Rat   281 PPIPFARPQDLGPTVAIVTKVNQIQDHLLKKHDTELYMHLNRLEIPPQIYGLRWVRLLFGREFPL 345

  Fly   585 AVVIRMWEACWSNYLTDYFHL----FLCLAIIAVYADDVVAQNLRPD-EMLLHF 633
            ..::.:|:|.::    |..||    ::..|::....|.:::.|.:.. .:|:|:
  Rat   346 QDLLVVWDALFA----DGLHLSLVDYVFTAMLLYIRDALISSNYQTCLGLLMHY 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 49/231 (21%)
Tbc1d5XP_008764990.1 TBC 79..381 CDD:214540 50/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.