DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and TBC1D25

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001335191.1 Gene:TBC1D25 / 4943 HGNCID:8092 Length:704 Species:Homo sapiens


Alignment Length:422 Identity:120/422 - (28%)
Similarity:182/422 - (43%) Gaps:96/422 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 SAMKC--------RHFSVDLSQMRSLRLFFNDDNCTSGQLVIASRESQYKILHFHYGGLDHLAQ- 308
            |..||        |.|:|| .|:.||       :.....|:.|...|..|.....|.|.|.|.| 
Human    55 SPQKCESFLPPEFRSFAVD-PQITSL-------DVLQHILIRAFDLSGKKNFGISYLGRDRLGQE 111

  Fly   309 ----VLHQWHCFLHNITSETGQDKFDLPYRHFMVCRPEVKKSEMHP--DEGDV------------ 355
                :|..|..          ...|....:.::..|.:::.||..|  ::.|:            
Human   112 VYLSLLSDWDL----------STAFATASKPYLQLRVDIRPSEDSPLLEDWDIISPKDVIGSDVL 166

  Fly   356 -----KKITT------------------------NFFYG----------------TLLNEKGQIE 375
                 ..:||                        ::.||                |.||.:||:.
Human   167 LAEKRSSLTTAALPFTQSILTQVGRTLSKVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLS 231

  Fly   376 DDLLLRKCVFFGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQ 440
            ....||..::.||:|.||||.||.:||..|....|..:|...|..|.:|||::..:.....:|| 
Human   232 RPEELRLRIYHGGVEPSLRKVVWRYLLNVYPDGLTGRERMDYMKRKSREYEQLKSEWAQRANPE- 295

  Fly   441 QIHFWKTVQIVVEKDVVRTDRTNPFFCG-DDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPV 504
            .:.|   ::..|.|||:||||.:|::.| :|.|:...:.::|..:||.:..:||.||||||.:|:
Human   296 DLEF---IRSTVLKDVLRTDRAHPYYAGPEDGPHLRALHDLLTTYAVTHPQVSYCQGMSDLASPI 357

  Fly   505 LCEVQNESETFWCFVGLMQRAFFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMELLF 569
            |..:.:|...|.||.|:|:|......|..|.:....::|:.|:|...|.||::| |...:.:|.|
Human   358 LAVMDHEGHAFVCFCGIMKRLAANFHPDGRAMATKFAHLKLLLRHADPDFYQYL-QEAGADDLFF 421

  Fly   570 CHRWLLLCFKREFTEAVVIRMWEACWSNYLTD 601
            |:|||||..||||.....:||.|..||:...|
Human   422 CYRWLLLELKREFAFDDALRMLEVTWSSLPPD 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 82/216 (38%)
TBC1D25NP_001335191.1 TBC 241..470 CDD:214540 82/218 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.