DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and grtp1

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001005632.1 Gene:grtp1 / 448089 XenbaseID:XB-GENE-950226 Length:342 Species:Xenopus tropicalis


Alignment Length:331 Identity:64/331 - (19%)
Similarity:126/331 - (38%) Gaps:70/331 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 SETGQD--------------KFDLPY-------RHFMVCRPEVKKSEMHPDEGDVKKITTNFFYG 365
            :||.||              :||..:       .|.::.|..:|.|:                  
 Frog     5 NETAQDSVPRIDGYGFVRPAEFDYAFYEEFIARYHVVLTRRAIKWSK------------------ 51

  Fly   366 TLLNEKGQIEDDLLLRKCVFFGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITR 430
             ||.:...:|.::.:::.: ..|:....|..||          .........||:....:     
 Frog    52 -LLQQSAAVEKNMKVKRYI-RKGIPNEHRSHVW----------MVVSGAQAQMDMNTGYF----- 99

  Fly   431 KRLYSMSPEQQIHFWKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEV-MKNILLNFAVYNTGMSYS 494
            :|:::...:..    |.:.:|: .|:.||...|..|..:.||:.:. :.|:|:.:..:|..:.|.
 Frog   100 RRMFTEGEKNP----KLLDLVI-TDLNRTFPDNVLFQKNANPSLQKDLYNVLVAYGQHNKTVGYC 159

  Fly   495 QGMSDLLAPVLCEVQNESETFW---CFVGLMQRAFFVCTPTDRDVDHNLSYLRELIRIMLPHFYK 556
            |||:.:...::...::|.:.||   ..:|.:...::....|....|..:  |.:|::..:|...:
 Frog   160 QGMNFIAGYLILVTKDEEKAFWLMDALIGQILPDYYSPAMTGLKTDQEV--LGDLVKKKIPSVAQ 222

  Fly   557 HLEQHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVA 621
            .:|.|. .|..|...||.:..|........|:|:|:..:.......|.:.|.| |....|..:.|
 Frog   223 LIETHG-VMWTLLVSRWFICLFIDILPVETVLRIWDCLFFEGSKVIFRVALTL-IKQSQASIMEA 285

  Fly   622 QNLRPD 627
            :|. ||
 Frog   286 RNF-PD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 47/234 (20%)
grtp1NP_001005632.1 TBC 69..283 CDD:214540 47/238 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.