DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and CG5916

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster


Alignment Length:235 Identity:50/235 - (21%)
Similarity:97/235 - (41%) Gaps:35/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 FWKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEV 508
            |.|.:...:..|:.||...|..|    :...:.:.|||:.:|.:|..:.|.||::.:...:|...
  Fly   106 FDKEISDSISIDLPRTFPDNIHF----DMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVT 166

  Fly   509 QNESETFWCFVGLMQRAFFVCTPTDRDVDHNLSYL-------RELIRIMLPHFYKHLEQHNDSME 566
            .:|.::||....:::..      ..:...||::.|       |||:...:|...:|:    |::.
  Fly   167 DDEEKSFWLLKHIVENI------VPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHV----DNLG 221

  Fly   567 L---LFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCL------AIIAVYADDVVA- 621
            |   :...:|.:..|........|:|:|:..::......|...|.:      ||:.  .||:.| 
  Fly   222 LPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILG--CDDIAAL 284

  Fly   622 QNLRPDEMLLH--FSSLAMYMDGQLILRKARGLLHQYRQL 659
            .||..|.|:..  .:....:::....||..|..|...|::
  Fly   285 ANLFRDTMIQDNIVTDCHGFVEAMFSLRLKRSELESLRKV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 38/189 (20%)
CG5916NP_001287357.1 TBC 67..276 CDD:214540 37/183 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456507
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.