DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and CG12241

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster


Alignment Length:357 Identity:75/357 - (21%)
Similarity:134/357 - (37%) Gaps:87/357 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 AQVLHQW--HC-FLHNITSETGQDKFDLPYRHFMVCRPEVKKSEMHPDEGDVKKITTNFFYGTLL 368
            ||...||  |. |.||      ::..:|.:.|..|..|..:|                     |.
  Fly   121 AQQRLQWIAHLEFSHN------KEAAELSWEHVDVMLPRTEK---------------------LR 158

  Fly   369 NEKGQIEDDLLLRKCVFFGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRL 433
            |         ::|:     |:..:||..:|..|...               :.:::..|.:...:
  Fly   159 N---------MVRQ-----GIPHTLRAQMWMRLSGA---------------LAKKQKSETSYHDI 194

  Fly   434 YSMSPEQQIHFWKTVQIVVEKDVVRTDRTNPFFCGDDNPN-TEV--MKNILLNFAVYNTGMSYSQ 495
            ...|...|:...|.    :|||::|...||..|   .||| |.:  ::.||...|.....:.|.|
  Fly   195 VKASSNDQLMTSKQ----IEKDLLRILPTNACF---SNPNGTGIPRLRRILRGIAWLFPDIGYCQ 252

  Fly   496 GMSDLLAPVLCEVQNESETFWCFV----GLMQRAFFVCTPTDRDVDHNLSYLRELIRIMLPHFYK 556
            |...::|.:|..::.|: .||...    .|:..:::..|......|..:  :..||...|....:
  Fly   253 GTGVIVACLLLFMEEEN-AFWMMATIVEDLLPASYYSSTLLGIQADQRV--MHTLIANYLSSVDE 314

  Fly   557 HLEQHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVA 621
            .|.:|:..:.|:..| |.|..|.......:::|:|:  |..|........|.|.::.|...|:  
  Fly   315 SLRKHDIELSLITLH-WFLTLFANVVHMKILVRIWD--WFFYEGSIVLFQLTLGMLKVKEQDL-- 374

  Fly   622 QNLRPDEMLLHFSSLA----MYMDGQLILRKA 649
            ::|.....:  |:||:    ...|.:::.|:|
  Fly   375 KHLENSAQI--FNSLSDIPGEVTDVEVLFRQA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 51/237 (22%)
CG12241NP_650432.1 TBC 161..375 CDD:214540 53/248 (21%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456509
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.