Sequence 1: | NP_609403.2 | Gene: | TBC1D16 / 34431 | FlyBaseID: | FBgn0032249 | Length: | 702 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006721967.1 | Gene: | TBC1D3C / 414060 | HGNCID: | 24889 | Length: | 610 | Species: | Homo sapiens |
Alignment Length: | 248 | Identity: | 47/248 - (18%) |
---|---|---|---|
Similarity: | 80/248 - (32%) | Gaps: | 86/248 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 386 FGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIK-RQEYEEITRKRLYSMSPEQQIHFWKTVQ 449
Fly 450 IVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESET 514
Fly 515 FWCFVGLM-----------------------QRAFFVCTPTDRDVDH--------NLSYLRELIR 548
Fly 549 IMLPHFYKHLEQHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTD 601 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TBC1D16 | NP_609403.2 | TBC | 387..618 | CDD:214540 | 47/247 (19%) |
TBC1D3C | XP_006721967.1 | TBC | 160..373 | CDD:214540 | 47/248 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |