DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and CG42795

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001287272.1 Gene:CG42795 / 41252 FlyBaseID:FBgn0261928 Length:3213 Species:Drosophila melanogaster


Alignment Length:345 Identity:75/345 - (21%)
Similarity:136/345 - (39%) Gaps:68/345 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 GGLEKSLRKTVWPFL----LKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQIHFWKT 447
            ||.....|:.:|..|    ||..:.....:......:..|::.||:                  .
  Fly   220 GGTPPEFRRKLWLSLADKYLKSKNVDWAQQREKCFCEEWREDDEEL------------------G 266

  Fly   448 VQIVVEKDVVRTDR---TNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQ 509
            :|||  ||:.||..   |.|    ..:.|...:|.|||.:|.||..:.|.||.:.|.|.:|..:.
  Fly   267 IQIV--KDLHRTGSNLCTGP----AGSINQAKLKRILLGYARYNPEVGYCQGFNMLGALILQVMD 325

  Fly   510 NESE-----TFWCFVGLMQRAFFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHNDSME--- 566
            .|.|     ..:...|::...:|..:......|  :...|||::..||...|||::....:|   
  Fly   326 KEEEESMKVMIYLVEGVLPTGYFYGSMGGLQAD--MGVFRELMQTRLPRLAKHLQRLQGPVENAF 388

  Fly   567 -----LLFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAII--AVYADDVVAQNL 624
                 .:|..:|.|..|......:.|:|:|:.    .|.:...:.|..|::  ::..:.|::.. 
  Fly   389 EPPLTNVFTMQWFLTMFCTCLPMSCVLRVWDL----VLIEGSDVLLRTALVLWSLLEERVISVR- 448

  Fly   625 RPDEMLLHFSSLAMY----MDGQLILRKARGLLHQYRQLPKIPCTLSGLCKRCGPGMWDSEHRPA 685
            ..||.   :..:..|    ::|.|:  .:.||:.:..:|..|. .|..|..:....:....|:..
  Fly   449 SADEF---YGKMGSYSSELLNGHLV--DSNGLIERVVKLGPIE-DLRQLRDKHLYNIAPLRHKQG 507

  Fly   686 LECV-----GHSDDEKCSLS 700
            |:..     .|||:|:.:::
  Fly   508 LQLYYDEEDTHSDEERLAVA 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 57/252 (23%)
CG42795NP_001287272.1 RabGAP-TBC 268..443 CDD:278964 47/186 (25%)
DUF4682 560..684 CDD:292361
DBP 1112..1415 CDD:289157
SWIRM-assoc_2 <2376..2482 CDD:293105
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456502
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.