DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and TBC1D10C

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001356427.1 Gene:TBC1D10C / 374403 HGNCID:24702 Length:454 Species:Homo sapiens


Alignment Length:242 Identity:53/242 - (21%)
Similarity:83/242 - (34%) Gaps:44/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 GLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQIHFWKTVQIVV 452
            |:..:||...||.|...:          |........|:|:...   ...|:     |..   .:
Human    92 GIPSALRARCWPLLCGAH----------VCQKNSPGTYQELAEA---PGDPQ-----WME---TI 135

  Fly   453 EKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDL-------LAPVLCEVQN 510
            .:|:.|....:..|........:.:..:|..:.:|.....|.|....:       |.|..|.:..
Human   136 GRDLHRQFPLHEMFVSPQGHGQQGLLQVLKAYTLYRPEQGYCQAQGPVAAVLLMHLPPEACALPL 200

  Fly   511 ESETFWCFVGLMQRAFFVCT--------PTDRDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMEL 567
            ..|.|||.|.       :|.        |....|..:......|:|.:|||.:|||:|.... .|
Human   201 PQEAFWCLVQ-------ICEVYLPGYYGPHMEAVRLDAEVFMALLRRLLPHVHKHLQQVGVG-PL 257

  Fly   568 LFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAV 614
            |:...|.|..|.|......|:|:|:|..|......|.:.|.|..:|:
Human   258 LYLPEWFLCLFARSLPFPTVLRVWDAFLSEGARVLFRVGLTLVRLAL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 53/242 (22%)
TBC1D10CNP_001356427.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
TBC 89..302 CDD:214540 52/238 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..454
Interaction with calcineurin 414..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.