DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and RN-tre

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_652381.1 Gene:RN-tre / 36554 FlyBaseID:FBgn0020620 Length:571 Species:Drosophila melanogaster


Alignment Length:385 Identity:86/385 - (22%)
Similarity:149/385 - (38%) Gaps:105/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 TSGQ----LVIASRESQYKILHFHYGGLDHLAQVLHQW-------------HCFLHNITSETGQD 327
            |.|:    ||..:.:.:..|...:..|||. :.|:..|             :.|||:....:.:|
  Fly     2 TDGEQQEALVKRAEDEREDIFRRYELGLDP-SNVVDSWENPTFEIYHRTDKYGFLHDSRLPSTRD 65

  Fly   328 KFDLPYRHFMVCRPEVKKSEMHPDEGDVKKITTNFFYGTLLNEKGQIEDDLLLRKCVFFGGLEKS 392
            ..:: :|:         |.||..|:..:|          :||:....:|.|..|   .:.|:...
  Fly    66 AQEV-HRN---------KIEMERDKKWMK----------MLNQWPPPQDKLHKR---VYKGIPDR 107

  Fly   393 LRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQ---------EYEEITRKRLYSMSPEQQIHFWKTV 448
            :|...|..||                ||::.         ...::.||  ||....|        
  Fly   108 VRMVAWNKLL----------------DIQQSINNNAGVYLRMLQLARK--YSTETRQ-------- 146

  Fly   449 QIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESE 513
               ::.||.|..|.|..|....:.....:.|:|..:::||:.:.|.|||: .:|.||....:|.|
  Fly   147 ---IDADVNRQFRDNLAFRERYSVKQCSLFNVLNAYSIYNSELGYCQGMA-CVAGVLLLYLHEEE 207

  Fly   514 TFWCFVGL-------MQRAFFVCTP-TDRDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMELLFC 570
            .||....|       |...|....| ..|.:||:...:.:::|.:..||.||   :.|:  ||:.
  Fly   208 AFWALNTLITDQKYGMHGLFIEGFPKLTRFIDHHDRIMSKIMRKLHKHFTKH---NVDA--LLYA 267

  Fly   571 HRWLLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVAQNLRPDEML 630
            .:|..:.|......::.:|:|:.    ::.|...:.|.:||..:|        |..||:|
  Fly   268 IKWFFVVFVERVPFSLSLRVWDI----FMLDGDRVILSMAITILY--------LHKDELL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 57/247 (23%)
RN-treNP_652381.1 TBC 100..315 CDD:214540 60/261 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456503
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.