DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and Sgsm3

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_942082.2 Gene:Sgsm3 / 362963 RGDID:735113 Length:763 Species:Rattus norvegicus


Alignment Length:364 Identity:75/364 - (20%)
Similarity:129/364 - (35%) Gaps:105/364 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 QWHC---FLHNITSETGQDKFDLPYRHFMVCRPEVKKSEMHPDEGDVKKITTNFFYGTLLNEKGQ 373
            :|..   |.||      .|..||.:....|..|..:|                            
  Rat    89 RWQAHLEFTHN------HDVGDLTWDKIAVSLPRSEK---------------------------- 119

  Fly   374 IEDDLLLRKCVFFGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQE--YEEITRKRLYSM 436
                  ||..| ..|:...:|..:|..|            ...|...|..|  |.||.:    :.
  Rat   120 ------LRSLV-LAGIPHGMRPQLWMRL------------SGALQKKKNSELSYREIVK----NS 161

  Fly   437 SPEQQIHFWKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLL 501
            |.::.|     ....:|||::||..:|..|...::.....::.:|...|.....:.|.|| :.::
  Rat   162 SNDETI-----AAKQIEKDLLRTMPSNACFANVNSIGVPRLRRVLRALAWLYPEIGYCQG-TGMV 220

  Fly   502 APVLCEVQNESETFW--CFV--GLMQRAFFVCT----PTDRDVDHNLSYLRELIRIMLPHFYKHL 558
            |..|.....|.:.||  |.:  .|:..::|..|    .||:.|      ||.||...||...|.|
  Rat   221 AACLLLFLEEEDAFWMMCAIIEDLLPASYFSTTLLGVQTDQRV------LRHLIVQYLPRLDKLL 279

  Fly   559 EQHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVAQN 623
            ::|:..:.|:..| |.|..|.......:::|:|:            ||.....:.::...:....
  Rat   280 QEHDIELSLITLH-WFLTAFASVVHIRLLLRIWD------------LFFYEGSLVLFQTTLGMLR 331

  Fly   624 LRPDEMLLHFSSLAMYM----------DGQLILRKARGL 652
            |:.:|::...:|.:::.          |.:|:|.:|..|
  Rat   332 LKEEELIQSENSASIFNTLSDIPAQMDDAELLLGEAMQL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 54/240 (23%)
Sgsm3NP_942082.2 TBC 127..338 CDD:214540 56/251 (22%)
SH3_SGSM3 497..549 CDD:212747
RUN 576..727 CDD:397055
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.