DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and Tbc1d10a

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001015022.1 Gene:Tbc1d10a / 360968 RGDID:1311641 Length:505 Species:Rattus norvegicus


Alignment Length:286 Identity:57/286 - (19%)
Similarity:103/286 - (36%) Gaps:66/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 GLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQIHFWKTVQIVV 452
            |:..|||...|.:|          ....|.:.....:::|:      .|||...  .|..   |:
  Rat   111 GIPPSLRGRAWQYL----------SGGKVKLQQNPGKFDEL------DMSPGDP--KWLD---VI 154

  Fly   453 EKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWC 517
            |:|:.|....:..|........:.:..:|..:.:|.....|.|..:.:.|.:|..:..| :.|||
  Rat   155 ERDLHRQFPFHEMFVSRGGHGQQDLFRVLKAYTLYRPEEGYCQAQAPIAAVLLMHMPAE-QAFWC 218

  Fly   518 FVGLMQRAF-------FVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMELLFCHRWLL 575
            .|.:.::..       ......|.::      |..|::.:.|..:|||.:.... .||:...|.:
  Rat   219 LVQVCEKYLPGYYSEKLEAIQLDGEI------LFSLLQKVSPVAHKHLSRQKID-PLLYMTEWFM 276

  Fly   576 LCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVAQNLRPDEMLLHFSSLAMYM 640
            ..|.|....:.|:|:|:            :|.|..:..::...:|        :|.|      .:
  Rat   277 CAFARTLPWSSVLRVWD------------MFFCEGVKIIFRVGLV--------LLKH------AL 315

  Fly   641 DGQLILRKARG---LLHQYRQL-PKI 662
            .....||..:|   .:.|.|.| |||
  Rat   316 GSPEKLRACQGQYETIEQLRSLSPKI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 45/236 (19%)
Tbc1d10aNP_001015022.1 TBC 110..313 CDD:214540 47/250 (19%)
VCX_VCY 404..>501 CDD:291884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.