DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and CG4041

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster


Alignment Length:293 Identity:66/293 - (22%)
Similarity:107/293 - (36%) Gaps:83/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 LRKTVWPFLL---------KCYSFSSTFEDRAVLMDIKR-QEYEEITRKRLYSMSPEQQIHFWKT 447
            ||..:|..||         |...|:||..||.:.:||.| .:|:|:.      .||:        
  Fly   436 LRGPIWAALLEVVPNGSYAKIDKFTSTSTDRQIEVDIPRCHQYDELL------SSPD-------- 486

  Fly   448 VQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVL-CEVQNE 511
                                     ....::.:|..:...:....|.||:..|.||.| ....||
  Fly   487 -------------------------GHRKLRRLLKAWVTAHPQYVYWQGLDSLTAPFLYLNFNNE 526

  Fly   512 SETF---WCFVGLMQRAFFVCTPTDRDVDHNLSYLRELIR--IMLPHFYKH-LEQHNDSMEL--- 567
            ...|   :.|:....:.||:     :|   |.:.::|.:.  ..|..|::. |.||..|:..   
  Fly   527 ELAFLSLFKFIPKYLQWFFL-----KD---NSAVIKEYLSKFSQLTAFHEPLLAQHLASISFIPE 583

  Fly   568 LFCHRWLLLCFKREFTEAVVIRMWEACW---SNYLTDYFHLFLCLAIIAVYADDVVAQNLRPDEM 629
            ||...|.|..|...|....::.:|:...   |:|     .||:.:||:......::....  :|.
  Fly   584 LFAIPWFLTMFSHVFPLHKILHLWDKLMLGDSSY-----PLFIGIAILRQLRSTLLTSGF--NEC 641

  Fly   630 LLHFSSLA-MYMDGQLILRKARGLLHQYRQLPK 661
            :|.||.|. :.||| .:|...:    .|...||
  Fly   642 ILLFSDLPDIVMDG-CVLESQK----MYEATPK 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 54/247 (22%)
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 54/249 (22%)
RHOD_Kc 706..810 CDD:238783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.