DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and Tbc1d25

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001100425.1 Gene:Tbc1d25 / 302552 RGDID:1559711 Length:688 Species:Rattus norvegicus


Alignment Length:263 Identity:92/263 - (34%)
Similarity:141/263 - (53%) Gaps:22/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 RPEVKKSEMHPDEGDVKKITTNFFYGTLLNEKGQIEDDLLLRKCVFFGGLEKSLRKTVWPFLLKC 404
            :|.:..:|.|                |.||.:||:.....||..::.||:|.||||.||.:||..
  Rat   196 KPPLSDAEFH----------------TYLNHEGQLSRPEELRLRIYHGGVEPSLRKVVWRYLLNV 244

  Fly   405 YSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQIHFWKTVQIVVEKDVVRTDRTNPFFCG- 468
            |....|..:|...|..|.:|||::..:....::|| .:.|   ::..|.|||:||||.:|::.| 
  Rat   245 YPDGLTGRERMDYMKRKSREYEQLKSEWAQRVNPE-DLEF---IRSTVLKDVLRTDRAHPYYAGP 305

  Fly   469 DDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWCFVGLMQRAFFVCTPTD 533
            :|.|:...:.::|..:||.:..:||.||||||.:|:|..:.:|...|.||.|:|:|......|..
  Rat   306 EDGPHLRALHDLLTTYAVTHPQVSYCQGMSDLASPILAVMDHEGHAFVCFCGIMKRLAANFHPDG 370

  Fly   534 RDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEACWSNY 598
            |.:....::|:.|:|...|.||::| |...:.:|.||:|||||..||||.....:||.|..||:.
  Rat   371 RAMATKFAHLKLLLRHADPDFYQYL-QEAGADDLFFCYRWLLLELKREFAFDDALRMLEVTWSSL 434

  Fly   599 LTD 601
            ..|
  Rat   435 PPD 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 82/216 (38%)
Tbc1d25NP_001100425.1 TBC 225..454 CDD:214540 82/218 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.