DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and Usp6nl

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_006254294.1 Gene:Usp6nl / 291309 RGDID:1311786 Length:833 Species:Rattus norvegicus


Alignment Length:231 Identity:59/231 - (25%)
Similarity:91/231 - (39%) Gaps:66/231 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 FGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYS--------MSPE-QQ 441
            :.|:...||..||                |:|::|.:.:.|  ||. |||        .||: :|
  Rat   115 YKGIPLQLRGEVW----------------ALLLEIPKMKEE--TRD-LYSKLKHRARGCSPDIRQ 160

  Fly   442 IHFWKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLC 506
            |          :.||.||.|.:..|........:.:.::|..:::|||.:.|.||||.:.| :|.
  Rat   161 I----------DLDVNRTFRDHIMFRDRYGVKQQSLFHVLAAYSIYNTEVGYCQGMSQITA-LLL 214

  Fly   507 EVQNESETFWCFVGLM------QRAFFVCTPTDRDVDHNLSYLRELIRIMLPH------FYKHLE 559
            ...||.:.||..|.|.      ...|||            ....:|:|....|      |...|:
  Rat   215 MYMNEEDAFWALVKLFSGPKHAMHGFFV------------QGFPKLLRFQEHHEKILNKFLSKLK 267

  Fly   560 QHNDSMEL---LFCHRWLLLCFKREFTEAVVIRMWE 592
            ||.||.|:   .:..:|...||.......:.:|:|:
  Rat   268 QHLDSQEIYTSFYTMKWFFQCFLDRTPFRLNLRIWD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 59/230 (26%)
Usp6nlXP_006254294.1 TBC 114..329 CDD:214540 59/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.