Sequence 1: | NP_609403.2 | Gene: | TBC1D16 / 34431 | FlyBaseID: | FBgn0032249 | Length: | 702 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074968.1 | Gene: | Tbc1d8b / 245638 | MGIID: | 1918101 | Length: | 1114 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 51/207 - (24%) |
---|---|---|---|
Similarity: | 77/207 - (37%) | Gaps: | 39/207 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 377 DLLLRKCVFFGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQ 441
Fly 442 IHFWKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLC 506
Fly 507 EVQNESETFWCFVGLMQRA---FFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHN--DSME 566
Fly 567 LLFCHRWLLLCF 578 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TBC1D16 | NP_609403.2 | TBC | 387..618 | CDD:214540 | 48/197 (24%) |
Tbc1d8b | NP_001074968.1 | PH-GRAM1_TBC1D8B | 156..254 | CDD:275419 | |
PH-GRAM2_TBC1D8B | 296..388 | CDD:270159 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 399..420 | ||||
TBC | 485..693 | CDD:214540 | 49/203 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 938..957 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1032..1061 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |