DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and TBC1D30

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_024304669.1 Gene:TBC1D30 / 23329 HGNCID:29164 Length:944 Species:Homo sapiens


Alignment Length:362 Identity:81/362 - (22%)
Similarity:145/362 - (40%) Gaps:94/362 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 GLEKSLRKTVWPFLLKCYSFSSTFE-DRAVLMDIKRQEYEEITRKRLYSMSPEQQIHFWKTVQIV 451
            |:.|..|:.||..|...|..|...: |:.:     |..:.|.:.....||.          :|||
Human   249 GIPKEWRRKVWLTLADHYLHSIAIDWDKTM-----RFTFNERSNPDDDSMG----------IQIV 298

  Fly   452 VEKDVVRTDRTNPFFCGDD-NPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQ--NESE 513
              ||:.||..::  :||.: ..:..|:|.:||.:|.:|..:.|.||. ::||.::.||.  ||.:
Human   299 --KDLHRTGCSS--YCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGF-NILAALILEVMEGNEGD 358

  Fly   514 TFWCFVGLMQR----AFFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQ------------HN 562
            .....:.|:.:    ::||.......||  ::..|:|:|:.||...:||:.            :.
Human   359 ALKIMIYLIDKVLPESYFVNNLRALSVD--MAVFRDLLRMKLPELSQHLDTLQRTANKESGGGYE 421

  Fly   563 DSMELLFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTDYFH-----LFLCLAIIAVYADDV--- 619
            ..:..:|..:|.|..|........|:::|::.       :|.     |.:.|||.|...:.:   
Human   422 PPLTNVFTMQWFLTLFATCLPNQTVLKIWDSV-------FFEGSEIILRVSLAIWAKLGEQIECC 479

  Fly   620 ----------------VAQN--LRPDEMLLHFSSLAMYMDGQLI-LRKARGLLHQYRQLP----K 661
                            :.:|  |:..|::....|:|.:...||. ||:.    :.|...|    .
Human   480 ETADEFYSTMGRLTQEMLENDLLQSHELMQTVYSMAPFPFPQLAELREK----YTYNITPFPATV 540

  Fly   662 IPCTLSGLCKRCGPGMWDSEHRP--------ALECVG 690
            .|.::||...:....  |.|:.|        |:.|:|
Human   541 KPTSVSGRHSKARDS--DEENDPDDEDAVVNAVGCLG 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 61/254 (24%)
TBC1D30XP_024304669.1 RabGAP-TBC 296..476 CDD:306939 48/193 (25%)
DUF4682 637..785 CDD:318030
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.