DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and TBC1D9

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_055945.2 Gene:TBC1D9 / 23158 HGNCID:21710 Length:1266 Species:Homo sapiens


Alignment Length:305 Identity:66/305 - (21%)
Similarity:118/305 - (38%) Gaps:80/305 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 DLLLRKCVFFGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRL--YSMSPE 439
            :|:|:      |:.:|:|..:|..|      |....::|.    ....||::..|.:  |:::.|
Human   510 ELVLK------GIPESMRGELWLLL------SGAINEKAT----HPGYYEDLVEKSMGKYNLATE 558

  Fly   440 QQIHFWKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPV 504
            :           :|:|:.|:...:|.|  .:......::.:|..:|..|..:.|.|.| :::..|
Human   559 E-----------IERDLHRSLPEHPAF--QNEMGIAALRRVLTAYAFRNPNIGYCQAM-NIVTSV 609

  Fly   505 LCEVQNESETFWCFVGLMQRA---FFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHNDSME 566
            |.....|.|.||..|.|.:|.   ::........||..:  ..||.|..:|..|       |.|:
Human   610 LLLYAKEEEAFWLLVALCERMLPDYYNTRVVGALVDQGV--FEELARDYVPQLY-------DCMQ 665

  Fly   567 LL-----FCHRWLLLCF--KREFTEAVVIRMWEACWSNYLTDYFH-----LF-LCLAIIAVYADD 618
            .|     ....|.|..|  ...|..|||:          :..:|:     :| |.||::....|.
Human   666 DLGVISTISLSWFLTLFLSVMPFESAVVV----------VDCFFYEGIKVIFQLALAVLDANVDK 720

  Fly   619 VVAQNLRPDEMLLHFSSLAMYMDGQLILRKARGLLHQYRQLPKIP 663
            ::  |.:.|...:  :.|..|:|         .:.::...||.||
Human   721 LL--NCKDDGEAM--TVLGRYLD---------SVTNKDSTLPPIP 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 54/248 (22%)
TBC1D9NP_055945.2 PH-GRAM1_TCB1D9_TCB1D9B 157..255 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 304..399 CDD:270161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..456
TBC 512..722 CDD:214540 56/258 (22%)
EFh <893..923 CDD:385324
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1075..1095
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1132..1164
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.