DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and Tbc1d25

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001159909.1 Gene:Tbc1d25 / 209815 MGIID:2444862 Length:723 Species:Mus musculus


Alignment Length:263 Identity:92/263 - (34%)
Similarity:141/263 - (53%) Gaps:22/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 RPEVKKSEMHPDEGDVKKITTNFFYGTLLNEKGQIEDDLLLRKCVFFGGLEKSLRKTVWPFLLKC 404
            :|.:..:|.|                |.||.:||:.....||..::.||:|.||||.||.:||..
Mouse   231 KPPLSDAEFH----------------TYLNHEGQLSRPEELRLRIYHGGVEPSLRKVVWRYLLNV 279

  Fly   405 YSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQIHFWKTVQIVVEKDVVRTDRTNPFFCG- 468
            |....|..:|...|..|.:|||::..:....::|| .:.|   ::..|.|||:||||.:|::.| 
Mouse   280 YPDGLTGRERMDYMKRKSREYEQLKSEWAQRVNPE-DLEF---IRSTVLKDVLRTDRAHPYYAGP 340

  Fly   469 DDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWCFVGLMQRAFFVCTPTD 533
            :|.|:...:.::|..:||.:..:||.||||||.:|:|..:.:|...|.||.|:|:|......|..
Mouse   341 EDGPHLRALHDLLTTYAVTHPQVSYCQGMSDLASPILAVMDHEGHAFVCFCGIMKRLAANFHPDG 405

  Fly   534 RDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEACWSNY 598
            |.:....::|:.|:|...|.||::| |...:.:|.||:|||||..||||.....:||.|..||:.
Mouse   406 RAMATKFAHLKLLLRHADPDFYQYL-QEAGADDLFFCYRWLLLELKREFAFDDALRMLEVTWSSL 469

  Fly   599 LTD 601
            ..|
Mouse   470 PPD 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 82/216 (38%)
Tbc1d25NP_001159909.1 TBC 260..489 CDD:214540 82/218 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.