DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and Tbc1d12

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_666064.3 Gene:Tbc1d12 / 209478 MGIID:2384803 Length:698 Species:Mus musculus


Alignment Length:297 Identity:58/297 - (19%)
Similarity:106/297 - (35%) Gaps:93/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 VFFGGLEKSLRKTVWPFLL----------------------KCYSFSSTFEDRAVLMDIKRQEYE 426
            :::.||..|:|..||...:                      |.:|.||:..|...|....|:...
Mouse   403 LWWQGLPPSVRGKVWSLAVGNELNITPELYEIFLSRAKERWKSFSESSSENDTEGLSVADREASL 467

  Fly   427 EITRKRLYSMSPEQQIHFWKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGM 491
            |:                       ::.|:.||..:...| ....|..:|:.:||..:..|...:
Mouse   468 EL-----------------------IKLDISRTFPSLYIF-QKGGPYHDVLHSILGAYTCYRPDV 508

  Fly   492 SYSQGMSDLLAPVLCEVQNESETFWCFVGLM----QRAFFVCTPTDRDVDHNLSYLRELIRIMLP 552
            .|.||||.:.|.::..:: |::.|..|..|:    |.|||       .|||::         ||.
Mouse   509 GYVQGMSFIAAVLILNLE-EADAFIAFANLLNKPCQLAFF-------RVDHSM---------MLK 556

  Fly   553 HFYKHLEQHNDSMELLFCH-------------RWLLLCFKREFTEAVVIRMWEA-CWSNYLTDYF 603
            :|........:::..||.|             .|:...:.:.....:..|:|:. |...   :.|
Mouse   557 YFATFEVFFEENLSKLFLHFKSYNLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDG---EEF 618

  Fly   604 HLFLCLAIIAVYADDVVAQNLRPDEMLLHFSSLAMYM 640
            .....|.|:.:| :|::.|        :.|..:|.::
Mouse   619 LFRTGLGILRLY-EDILLQ--------MDFIHIAQFL 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 54/270 (20%)
Tbc1d12NP_666064.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..236
COG5210 304..639 CDD:227535 56/288 (19%)
RabGAP-TBC 468..635 CDD:278964 42/211 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.