DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and TBC1D21

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_006720472.1 Gene:TBC1D21 / 161514 HGNCID:28536 Length:399 Species:Homo sapiens


Alignment Length:310 Identity:71/310 - (22%)
Similarity:139/310 - (44%) Gaps:43/310 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 RPEVKKSEMHPDEGDVKKITTNFF--YGTLLNEKGQIEDDLLLRKCVFFGGLEKSLRKTVWPFLL 402
            :|.:.|:|.           .:||  .|.|...:..|..::|.|      ||...:|...|.||.
Human    24 KPPIDKTEW-----------DSFFDESGHLAKSRDFICVNILER------GLHPFVRTEAWKFLT 71

  Fly   403 KCYSFSSTFEDRAVLMDIKRQEYEEITR---------KRLYSMSPEQQIHFWKTVQIVVEKDVVR 458
            ..:|:.|:.::|..:..::|:.|:.:.:         :.|:....|.:.:..:.:|.:.:||.: 
Human    72 GYFSWQSSQDERLTVDSMRRKNYKALCQMYEKIQPLLENLHRNFTETRNNIARDIQKIYDKDPL- 135

  Fly   459 TDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWCFVGLMQ 523
                     |:...:.:.::.|||...|.||...|.||..:::......|:::.||||.|...:|
Human   136 ---------GNVLIDKKRLEKILLLSYVCNTQAEYQQGFHEMMMLFQLMVEHDHETFWLFQFFLQ 191

  Fly   524 RAFFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLE-QHNDSMELLFCHRWLLLCFKREFTE-AV 586
            :....|. .:..|..||..|..||..:.|.|.:||: :...:::.||  .|...||:|.|.. ..
Human   192 KTEHSCV-INIGVAKNLDMLSTLITFLDPVFAEHLKGKGAGAVQSLF--PWFCFCFQRAFKSFDD 253

  Fly   587 VIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVAQNLRPDEMLLHFSSL 636
            |.|:||...:......|.:.:..:::.:..:.|:.:::..|::||..::|
Human   254 VWRLWEVLLTGKPCRNFQVLVAYSMLQMVREQVLQESMGGDDILLACNNL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 56/241 (23%)
TBC1D21XP_006720472.1 TBC 62..287 CDD:214540 54/237 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.