DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and TBC1D8

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_005263919.1 Gene:TBC1D8 / 11138 HGNCID:17791 Length:1162 Species:Homo sapiens


Alignment Length:404 Identity:87/404 - (21%)
Similarity:141/404 - (34%) Gaps:118/404 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 LHFHYGGLDHLAQ-VLHQW-----HCF--LHNITSETGQDKFDLPYRHFMVCRPEVKKSE-MHPD 351
            :|:.....|.:|. |.|..     |.|  |..::|:..::.             |.:||. ||||
Human   422 VHYDTSADDDMASLVFHSTSMCSDHRFGDLEMMSSQNSEES-------------EKEKSPLMHPD 473

  Fly   352 EGDVKKITTNFFYGTLLNEKG-QIEDDLLLRK------------------CVF---------FGG 388
                 .:.|.|      .:.| |..|..:.|:                  |:|         ..|
Human   474 -----ALVTAF------QQSGSQSPDSRMSREQIKISLWNDHFVEYGRTVCMFRTEKIRKLVAMG 527

  Fly   389 LEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQIHFWKTVQIVVE 453
            :.:|||..:|  ||    ||....|.|             :....|....|:.:.....|...:|
Human   528 IPESLRGRLW--LL----FSDAVTDLA-------------SHPGYYGNLVEESLGKCCLVTEEIE 573

  Fly   454 KDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWCF 518
            :|:.|:...:|.|  .:......::.:|..:|..|..:.|.|.| ::|..||.....|.|.||..
Human   574 RDLHRSLPEHPAF--QNETGIAALRRVLTAYAHRNPKIGYCQSM-NILTSVLLLYTKEEEAFWLL 635

  Fly   519 VGLMQRA---FFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHND-----SMELLFCHRWLL 575
            |.:.:|.   :|........||.  |...|||:..||...:|:   ||     |:.|    .|.|
Human   636 VAVCERMLPDYFNHRVIGAQVDQ--SVFEELIKGHLPELAEHM---NDLSALASVSL----SWFL 691

  Fly   576 LCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVAQNLRPDEMLLHFSSLAMYM 640
            ..|.........:.:.:..:.:.:...|.  |.||::...|:|:.:..                .
Human   692 TLFLSIMPLESAVNVVDCFFYDGIKAIFQ--LGLAVLEANAEDLCSSK----------------D 738

  Fly   641 DGQLILRKARGLLH 654
            |||.::..:|.|.|
Human   739 DGQALMILSRFLDH 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 56/238 (24%)
TBC1D8XP_005263919.1 PH-GRAM1_TBC1D8 178..276 CDD:270156
PH-GRAM2_TBC1D8 318..413 CDD:270160
TBC 527..733 CDD:214540 56/238 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.