DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and TBC1D3E

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001278395.1 Gene:TBC1D3E / 102723859 HGNCID:27071 Length:549 Species:Homo sapiens


Alignment Length:337 Identity:65/337 - (19%)
Similarity:107/337 - (31%) Gaps:128/337 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 LDHLAQVLHQWHCFLHNITSETGQDKFDLP---YRHFMVCRPEV-KKSEMHPDEGDVKKITTNFF 363
            :|||            .|..||     :||   .|.....|.|: :||:.....||.:|..::  
Human    46 VDHL------------GIVHET-----ELPPLTAREAKQIRREISRKSKWVDMLGDWEKYKSS-- 91

  Fly   364 YGTLLNEKGQIEDDLLLRKCV--FFGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIK-RQEY 425
                             ||.:  .:.|:..::|..:|..||...........|..:|..| ::..
Human    92 -----------------RKLIDQAYKGMPMNIRGPMWSVLLNTEEMKLKNPGRYQIMKEKGKKSS 139

  Fly   426 EEITRKRLYSMSPEQQIHFWKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTG 490
            |.|.|                     :::||..|.|.:.||..........:.:|||.:..||..
Human   140 EHIQR---------------------IDRDVSGTLRKHIFFRDRYGTKQRELLHILLAYEEYNPE 183

  Fly   491 MSYSQGMSDLLAPVLCEVQNESETFWCFVGLM-----------------------QRAFFVCTPT 532
            :.|.:.:|.:.|..|..:. |.:.||..|.|:                       |:...|.|..
Human   184 VGYCRDLSHIAALFLLYLP-EEDAFWALVQLLASERHSLQGFHSPNGGTVQGLQDQQEHVVATSQ 247

  Fly   533 DRDVDH--------NLSYLRELIRIMLPHFYKHLEQHNDSMELLFCHRWLLLCFKREFTEAVVIR 589
            .:.:.|        ..|.|..||||::           |.:.|                 .:.:|
Human   248 PKTMGHQDKKDLCGQCSPLGCLIRILI-----------DGISL-----------------GLTLR 284

  Fly   590 MWEACWSNYLTD 601
            :|:.    ||.:
Human   285 LWDV----YLVE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 47/247 (19%)
TBC1D3ENP_001278395.1 TBC 99..312 CDD:214540 47/248 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.