DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and TBC1D3D

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_006722311.1 Gene:TBC1D3D / 101060389 HGNCID:28944 Length:610 Species:Homo sapiens


Alignment Length:248 Identity:47/248 - (18%)
Similarity:80/248 - (32%) Gaps:86/248 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 FGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIK-RQEYEEITRKRLYSMSPEQQIHFWKTVQ 449
            :.|:..::|..:|..||...........|..:|..| ::..|.|.|                   
Human   160 YKGMPMNIRGPMWSVLLNTEEMKLKNPGRYQIMKEKGKRSSEHIQR------------------- 205

  Fly   450 IVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESET 514
              :::||..|.|.:.||..........:.:|||.:..||..:.|.:.:|.:.|..|..:. |.:.
Human   206 --IDRDVSGTLRKHIFFRDRYGTKQRELLHILLAYEEYNPEVGYCRDLSHIAALFLLYLP-EEDA 267

  Fly   515 FWCFVGLM-----------------------QRAFFVCTPTDRDVDH--------NLSYLRELIR 548
            ||..|.|:                       |:...|.|...:.:.|        ..|.|..|||
Human   268 FWALVQLLASERHSLQGFHSPNGGTVQGLQDQQEHVVATSQPKTMGHQDKKDLCGQCSPLGCLIR 332

  Fly   549 IMLPHFYKHLEQHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTD 601
            |::           |.:.|                 .:.:|:|:.    ||.:
Human   333 ILI-----------DGISL-----------------GLTLRLWDV----YLVE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 47/247 (19%)
TBC1D3DXP_006722311.1 TBC 160..373 CDD:214540 47/248 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.