DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and tbc1d25

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_031746851.1 Gene:tbc1d25 / 100495342 XenbaseID:XB-GENE-876960 Length:651 Species:Xenopus tropicalis


Alignment Length:263 Identity:90/263 - (34%)
Similarity:139/263 - (52%) Gaps:22/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 RPEVKKSEMHPDEGDVKKITTNFFYGTLLNEKGQIEDDLLLRKCVFFGGLEKSLRKTVWPFLLKC 404
            :|.:..||.|                |.|:.:||:.....||..::.||:|.||||.||.:||..
 Frog   124 KPPLSDSEFH----------------TYLSHEGQLTRPEELRLRIYHGGVEPSLRKVVWRYLLNV 172

  Fly   405 YSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQIHFWKTVQIVVEKDVVRTDRTNPFFCG- 468
            |....:.::|...|..|.:||.::..:.|.....| .:.|   :|..|.|||:|||||:|::.| 
 Frog   173 YPDGLSGQERMDYMKCKTREYYQLKGEWLQRCGAE-DLEF---IQGNVMKDVLRTDRTHPYYAGS 233

  Fly   469 DDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWCFVGLMQRAFFVCTPTD 533
            :|||:.:.:.::|..:||.:..:||.|||||:.:|:|..:.||:..|.||.|:|:|.........
 Frog   234 EDNPHLQALHDLLSTYAVTHPQVSYCQGMSDIASPILAVMDNEAHAFICFCGIMKRLEGNFRMDG 298

  Fly   534 RDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEACWSNY 598
            ..:.....:|:.|:|...|.|:.:|.... :.:||||:|||||..||||.....:||.|..||:.
 Frog   299 ECMSVKFCHLKLLLRHSDPDFHSYLLSRG-ADDLLFCYRWLLLELKREFAFEDALRMLEVMWSSL 362

  Fly   599 LTD 601
            ..|
 Frog   363 PPD 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 80/216 (37%)
tbc1d25XP_031746851.1 TBC 153..366 CDD:214540 80/218 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.