DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIB and BRF1

DIOPT Version :9

Sequence 1:NP_001260349.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_011762.1 Gene:BRF1 / 853161 SGDID:S000003478 Length:596 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:70/282 - (24%)
Similarity:130/282 - (46%) Gaps:34/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DMICSECGLVVGDR--VIDVGSEWRTFSNEKSGVDPSRVGGPENPLLSGGDLSTIIGPGTGSASF 92
            |::|..||:|..|.  |.:|     ||....:|.          .::.|    :.||.|...|:|
Yeast    22 DLVCKACGVVSEDNPIVSEV-----TFGETSAGA----------AVVQG----SFIGAGQSHAAF 67

  Fly    93 DAFGAPKYQNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDGKNLKGRSNDA 157
            ....|        :.|.:.:|.:|.:::.:::..:::|:.|.|.|...:|.......::||.:..
Yeast    68 GGSSA--------LESREATLNNARRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGRRSQN 124

  Fly   158 KASACLYIACRQEGVPRTFKEICAVSKISKKEIGRCFKLTLKALE-TSVDLITTADFMCRFCANL 221
            ..::|||:|||:|.......:..:..::|...||..|...:|.|. |.:.|...:.|:..|...|
Yeast   125 VIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGATFLKMVKKLHITELPLADPSLFIQHFAEKL 189

  Fly   222 DLPN---MVQRAATHIAKKAVEMDIVPGRSPISVAAAAIYMASQASEHKRSQKEIGDIAGVADVT 283
            ||.:   .|.:.|..:|::..:..:..||.|..:|.|.|.:|.:.:..:|:..||..::.||:.|
Yeast   190 DLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMNNLRRTHTEIVAVSHVAEET 254

  Fly   284 IRQSY-KLMYPHAAKLFPEDFK 304
            ::|.. :.....||||..:.|:
Yeast   255 LQQRLNEFKNTKAAKLSVQKFR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIBNP_001260349.1 SUA7 22..289 CDD:224323 65/265 (25%)
BRF1NP_011762.1 SUA7 1..261 CDD:224323 65/265 (25%)
BRF1 463..595 CDD:400202
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.