DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIB and PBRP

DIOPT Version :9

Sequence 1:NP_001260349.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_195383.1 Gene:PBRP / 829817 AraportID:AT4G36650 Length:503 Species:Arabidopsis thaliana


Alignment Length:316 Identity:89/316 - (28%)
Similarity:136/316 - (43%) Gaps:53/316 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CSECGLVVGDRVIDVGSEWRTFSNEKSGVDPSRVGGPENPL-LSGGDLSTIIGPG---------- 86
            ||.||.|:.:|             :........:...:.|| |...||.|...|.          
plant    25 CSSCGRVMEER-------------QTQNHHLFHLRAQDTPLCLVTSDLQTAAQPSPEDEEDPFEP 76

  Fly    87 TG-------------------SASFDAFGAPKYQNRRTMSSSDRSLIS--------AFKEISSMA 124
            ||                   |.||....|...:.....||:..|..|        |:.:|..:|
plant    77 TGFITAFSTWSLEPSPIFARSSLSFSGHLAELERTLELASSTSNSNSSTVVVDNLRAYMQIIDVA 141

  Fly   125 DRINLPKTIVDRANNLFKQVHDGKNLKGRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKE 189
            ..:.|...|.:.|..||:.......|:.||.:|.|:|||..|.|:...|||.:||...:.:.:||
plant   142 SILGLDCDISEHAFQLFRDCCSATCLRNRSVEALATACLVQAIREAQEPRTLQEISIAANVQQKE 206

  Fly   190 IGRCFKLTLKALETS--VDLITTADFMCRFCANLDLPNMVQRAATHIAKKAVEMDIVPGRSPISV 252
            ||:..|:..:||:.|  ::..:.:..|.|||..|.|....|..||||.:..:.......|:|||:
plant   207 IGKYIKILGEALQLSQPINSNSISVHMPRFCTLLQLNKSAQELATHIGEVVINKCFCTRRNPISI 271

  Fly   253 AAAAIYMASQASEHKRSQKEIGDIAGVADVTIRQSYKLMYPHAAKLFPEDFKFTTP 308
            :|||||:|.|..:.:::|.||..|.|:.:||:|:.||.:..:...|.|.::....|
plant   272 SAAAIYLACQLEDKRKTQAEICKITGLTEVTLRKVYKELLENWDDLLPSNYTPAVP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIBNP_001260349.1 SUA7 22..289 CDD:224323 84/295 (28%)
PBRPNP_195383.1 SUA7 <132..313 CDD:224323 63/180 (35%)
CYCLIN 133..214 CDD:238003 28/80 (35%)
CYCLIN 233..311 CDD:238003 32/77 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729732at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.