DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIB and AT3G57370

DIOPT Version :9

Sequence 1:NP_001260349.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001319778.1 Gene:AT3G57370 / 824904 AraportID:AT3G57370 Length:362 Species:Arabidopsis thaliana


Alignment Length:338 Identity:89/338 - (26%)
Similarity:135/338 - (39%) Gaps:82/338 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CSECGLVVGDRVIDVGSEWRTFSNEKSGV---DPSRVGGPENPLLSGGDLSTI------------ 82
            |..|||....|.|          .:.|.|   |..|:..|.|.|||..|||.:            
plant    28 CFGCGLEFKYRPI----------GDLSPVAENDTVRLPDPTNTLLSNTDLSIVTTEHKNGSFDDS 82

  Fly    83 --IGPGTGS-----------------ASFDAFGAPKYQNRRTM-SSSDRSLIS------------ 115
              :..|..|                 :|.|.......||..|: :|||..|.|            
plant    83 LSLNLGNSSKPRLDPVSIATAKLMNGSSNDFLSLGTSQNSETITASSDEFLFSDLGHLQKFSFDP 147

  Fly   116 ------------AFKEISSMADRINLPKTIVDRANNLFKQVHDGKNLKGRSNDAKASACLYIACR 168
                        :...|.::::.:.||.||..:||.:||.|.  ...:|:..:...:||:|||||
plant   148 LSMASTKPNKALSIVSIEAISNGLKLPATIKGQANEIFKVVE--SYARGKERNVLFAACIYIACR 210

  Fly   169 QEGVPRTFKEICA-VSKISKKEIGRCFKLTLKALETSVD---LITTADFMCRFCANLDLPNMVQR 229
            ...:.||.:||.. .:|.|..:|........:.||.:.:   .|.||:|:.|||:...|......
plant   211 DNDMTRTMREISRFANKASISDISETVGFIAEKLEINKNWYMSIETANFIKRFCSIFRLDKEAVE 275

  Fly   230 AATHIAKKAVEMDIVPG----RSPISVAAAAIYMASQASEHKRSQKEIGDIAGVADVTIRQSYKL 290
            ||...|:   ..|.:..    |:|:||||..:|:.::.|..|...|.:.:..|||:.||:.:|..
plant   276 AALEAAE---SYDYMTNGCSRRAPVSVAAGIVYVIARLSYEKHLLKGLIEATGVAENTIKGTYGD 337

  Fly   291 MYPHAAKLFPEDF 303
            :||:...:.|..|
plant   338 LYPNLPTIVPTWF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIBNP_001260349.1 SUA7 22..289 CDD:224323 84/322 (26%)
AT3G57370NP_001319778.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729732at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.