DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIB and Brf1

DIOPT Version :9

Sequence 1:NP_001260349.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_082469.2 Gene:Brf1 / 72308 MGIID:1919558 Length:676 Species:Mus musculus


Alignment Length:272 Identity:67/272 - (24%)
Similarity:113/272 - (41%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DYRAGDMICSECGLVVGDRVIDVGSEWRTFSNEKSGVDPSRV-------GGPENPLLSGGDLSTI 82
            |...||.:|:.||.|:.|.:|  .||.:...|  ||...|.|       |..:.|.|.||     
Mouse    17 DAARGDAVCTGCGSVLEDNII--VSEVQFVEN--SGGGSSAVGQFVSLDGAGKTPTLGGG----- 72

  Fly    83 IGPGTGSASFDAFGAPKYQNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDG 147
            .....|..|    .|...||.|             :.|..:..::.|.:..:|.|.|.||.....
Mouse    73 FHVNLGKES----RAQTLQNGR-------------RHIHHLGSQLQLNQHCLDTAFNFFKMAVSK 120

  Fly   148 KNLKGRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKEIGRCFKLTLKALETSVDLITTAD 212
            ...:||......:||||:.||.||.|....::..:.:::...:|:.|.|..:.|..:...|....
Mouse   121 HLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCL 185

  Fly   213 FMCRFCANLDL---PNMVQRAATHIAKKAVEMDIVPGRSPISVAAAAIYMASQASEHKRSQKEIG 274
            ::.||...|:.   .:.|...|..:.::.....:..||.|..:..||:.:|::..:.:|:.||:.
Mouse   186 YIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVI 250

  Fly   275 DIAGVADVTIRQ 286
            .:..|.:.|:|:
Mouse   251 SVVKVCESTLRK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIBNP_001260349.1 SUA7 22..289 CDD:224323 67/272 (25%)
Brf1NP_082469.2 SUA7 4..266 CDD:224323 67/272 (25%)
Repetitive region 91..172 21/80 (26%)
Repetitive region 185..269 17/78 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 386..408
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..449
BRF1 449..546 CDD:369495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 617..653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.