DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIB and AT1G30455

DIOPT Version :10

Sequence 1:NP_476888.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001117389.1 Gene:AT1G30455 / 6240845 AraportID:AT1G30455 Length:254 Species:Arabidopsis thaliana


Alignment Length:76 Identity:21/76 - (27%)
Similarity:31/76 - (40%) Gaps:9/76 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 DLITTADFMCRFCANL---DLPNMVQRAATHIAKKAVEMDIVPGRSPISVAAAAIYMA------S 261
            :|:..:.|:.||...|   .....|...||||........:..||.|..:..||:|.|      |
plant    12 NLVDPSTFIPRFSNKLLKGAHNKQVVETATHIIASMKSNWMQTGRKPSGICGAALYTAALSHGGS 76

  Fly   262 QASEHKRSQKE 272
            .....:|::||
plant    77 DPPSFQRAEKE 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIBNP_476888.1 SUA7 1..289 CDD:441015 21/76 (28%)
AT1G30455NP_001117389.1 CYCLIN_SF 13..>74 CDD:477360 17/60 (28%)
BRF1 111..215 CDD:462250
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.