DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIB and Brf

DIOPT Version :9

Sequence 1:NP_001260349.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001163636.1 Gene:Brf / 42087 FlyBaseID:FBgn0038499 Length:662 Species:Drosophila melanogaster


Alignment Length:267 Identity:64/267 - (23%)
Similarity:120/267 - (44%) Gaps:24/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EDYRAGDMICSECGLVVGDRVIDVGSEWRTFSNEKSGVDPSRVGGPENPLLSGGDLSTIIGPGTG 88
            ||...||.:|..||.|:.|.:|....::     |:.|...:.:|...:...|||..:        
  Fly    17 EDNARGDRVCMNCGSVLEDSLIVSEVQF-----EEVGHGAAAIGQFVSAESSGGATN-------- 68

  Fly    89 SASFDAFGAPKYQNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDGKNL-KG 152
                  :|..|:|......|.:.::..|.|:|:.:..::.|.:...|.|.|.||... |::| :|
  Fly    69 ------YGYGKFQVGSGTESREVTIKKAKKDITLLCQQLQLSQHYADTALNFFKMAL-GRHLTRG 126

  Fly   153 RSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKEIGRCFKLTLKALETSVDLITTADFMCRF 217
            |.:....:||:|:.||.||......:|..|.:|...|:||.:.....||..::..:....::.||
  Fly   127 RKSTHIYAACVYMTCRTEGTSHLLIDISDVQQICSYELGRTYLKLSHALCINIPSLDPCLYIMRF 191

  Fly   218 CANLDL---PNMVQRAATHIAKKAVEMDIVPGRSPISVAAAAIYMASQASEHKRSQKEIGDIAGV 279
            ...|.|   .:.|...|..|.::..:..:..||.|..:..||:.:|::..:..|:..::..:..:
  Fly   192 ANRLQLGAKTHEVSMTALRIVQRMKKDCMHSGRRPTGLCGAALLIAARMHDFSRTMLDVIGVVKI 256

  Fly   280 ADVTIRQ 286
            .:.|:|:
  Fly   257 HESTLRK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIBNP_001260349.1 SUA7 22..289 CDD:224323 64/267 (24%)
BrfNP_001163636.1 TF_Zn_Ribbon 5..44 CDD:285471 10/26 (38%)
SUA7 6..270 CDD:224323 64/267 (24%)
CYCLIN 108..164 CDD:294043 19/56 (34%)
CYCLIN 183..268 CDD:238003 16/81 (20%)
BRF1 441..531 CDD:285040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438925
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.