DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIB and brf1a

DIOPT Version :9

Sequence 1:NP_001260349.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_956192.1 Gene:brf1a / 334402 ZFINID:ZDB-GENE-030131-6334 Length:661 Species:Danio rerio


Alignment Length:294 Identity:67/294 - (22%)
Similarity:130/294 - (44%) Gaps:30/294 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DYRAGDMICSECGLVVGDRVIDVGSEWRTFSNEKSGVDPSRVGGPENPLLSGGDLSTIIG---PG 86
            |...|..:|..||.|:.|.:|         .:|.:.|:            |||..|:.:|   .|
Zfish    15 DQARGVAVCMGCGSVLEDNII---------VSEVTFVE------------SGGGGSSAVGQFVAG 58

  Fly    87 TGSASFDAFGAPKYQNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDGKNLK 151
            ..|.:..:.|. .:|......|...:|.:|.::|:.:..::.:.:..:|.|.|.:|........|
Zfish    59 DASGNVPSLGG-NFQTSVGRESRAATLQNAKRQINHLGHQLQMNQHCLDTAFNFYKMALSKHLTK 122

  Fly   152 GRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKEIGRCFKLTLKALETSVDLITTADFMCR 216
            ||.:....:||||:.||.||.|....::..:.:::...:|:.|.:..:.|..:...|....::.|
Zfish   123 GRKSTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLVLARELCINAPAIDPCLYIPR 187

  Fly   217 FCANLDL---PNMVQRAATHIAKKAVEMDIVPGRSPISVAAAAIYMASQASEHKRSQKEIGDIAG 278
            |...|:.   .:.|...|..:.::.....:..||.|..:..||:.:|::..|.:|:.||:..:..
Zfish   188 FAQLLEFGEKSHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHEFRRTIKEVISVVK 252

  Fly   279 VADVTIRQS-YKLMYPHAAKLFPEDFKFTTPIDQ 311
            |.:.|:|:. |:......::|..|:| ..|.::|
Zfish   253 VCEATLRKRLYEFEDTPTSELTIEEF-MKTDLEQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIBNP_001260349.1 SUA7 22..289 CDD:224323 61/270 (23%)
brf1aNP_956192.1 SUA7 1..277 CDD:224323 63/283 (22%)
TF_Zn_Ribbon 3..41 CDD:285471 9/34 (26%)
CYCLIN 83..156 CDD:238003 19/72 (26%)
CYCLIN 185..258 CDD:294043 16/72 (22%)
BRF1 439..531 CDD:285040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.