DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIB and brf1b

DIOPT Version :9

Sequence 1:NP_001260349.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_956183.1 Gene:brf1b / 334316 ZFINID:ZDB-GENE-030131-6248 Length:693 Species:Danio rerio


Alignment Length:281 Identity:66/281 - (23%)
Similarity:119/281 - (42%) Gaps:44/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SPLIEDYRAGDMICSECGLVVGDRVIDVGSEWRTFSNEKSGVDPSRVGGPENPLLSGGDLSTIIG 84
            |.:..|...|..:|:.||.|:.|.:|                 .|.|...||   ||| :|:.:|
Zfish    11 SDIDTDPARGSAVCTACGSVLEDNII-----------------VSEVQFVEN---SGG-VSSAVG 54

  Fly    85 -----------PGTGSASFDAFGAPKYQNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRAN 138
                       |..||....:.|  |....:|:.:..|       :|.::..::.|.:..:|.|.
Zfish    55 QFVSADGTSKAPVLGSGFHTSLG--KESRAQTLQNGKR-------QIHNLGSQLQLNQHCLDTAF 110

  Fly   139 NLFKQVHDGKNLKGRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKEIGRCFKLTLKALET 203
            |.||.|......:||......:||||:.||.||.|....::..:.:::...:|:.|.|..:.|..
Zfish   111 NFFKMVVSKHLTRGRKMTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYILGKTFLLLARELCI 175

  Fly   204 SVDLITTADFMCRFCANLDL---PNMVQRAATHIAKKAVEMDIVPGRSPISVAAAAIYMASQASE 265
            :...:....::.||...|:.   .:.|...|..:.::.....:..||.|..:..||:.:|::..|
Zfish   176 NAPAVDPCLYIPRFAHMLEFGEKTHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHE 240

  Fly   266 HKRSQKEIGDIAGVADVTIRQ 286
            .:|:.||:..:..|.:.|:|:
Zfish   241 FRRTVKEVISVVKVCETTLRK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIBNP_001260349.1 SUA7 22..289 CDD:224323 65/279 (23%)
brf1bNP_956183.1 SUA7 2..265 CDD:224323 66/281 (23%)
TF_Zn_Ribbon 3..42 CDD:285471 11/47 (23%)
CYCLIN 92..169 CDD:238003 21/76 (28%)
CYCLIN 186..259 CDD:294043 16/72 (22%)
BRF1 461..552 CDD:285040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.