DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIB and Brf1

DIOPT Version :9

Sequence 1:NP_001260349.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001100231.1 Gene:Brf1 / 299347 RGDID:1311158 Length:686 Species:Rattus norvegicus


Alignment Length:310 Identity:59/310 - (19%)
Similarity:102/310 - (32%) Gaps:102/310 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DYRAGDMICSECGLVVGDRVIDVGSEWRTFSNEKSGVDPSRV-------GGPENPLLSGG----- 77
            |...||.:|:.||.|:.|.:|  .||.:...|  ||...|.|       |..:.|.|.||     
  Rat    17 DAARGDAVCTGCGSVLEDNII--VSEVQFVEN--SGGGSSAVGQFVSLDGAGKTPTLGGGFHVNL 77

  Fly    78 -------------------DLSTIIGPGTGSASFDAFGAPKYQNRRTMSSSDRSLISAFKEISSM 123
                               |.......|.|:|.....|.|                        :
  Rat    78 GKESRAQTLQNGILYFILADHGVGQDAGVGAAPHPPPGEP------------------------V 118

  Fly   124 ADRINLPKTIVDRANNLFKQVHDGKNLKGRSNDAKASACLYIACRQEGVPRT------------- 175
            |....||       .:..:.:.||                   |:|...|||             
  Rat   119 ATEPALP-------GHSLQLLQDG-------------------CKQASYPRTENGPCDCCLPLLD 157

  Fly   176 -FKEICAVSKISKKEIGRCFKLTLKALETSVDLITTADFMCRFCANLDL---PNMVQRAATHIAK 236
             ..::..:.:::...:|:.|.|..:.|..:...|....::.||...|:.   .:.|...|..:.:
  Rat   158 MLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQ 222

  Fly   237 KAVEMDIVPGRSPISVAAAAIYMASQASEHKRSQKEIGDIAGVADVTIRQ 286
            :.....:..||.|..:..||:.:|::..:.:|:.||:..:..|.:.|:|:
  Rat   223 RMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIBNP_001260349.1 SUA7 22..289 CDD:224323 59/310 (19%)
Brf1NP_001100231.1 SUA7 4..276 CDD:224323 59/310 (19%)
TF_Zn_Ribbon 4..43 CDD:285471 11/27 (41%)
CYCLIN 197..270 CDD:294043 15/72 (21%)
BRF1 463..555 CDD:285040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.