DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIB and brf-1

DIOPT Version :9

Sequence 1:NP_001260349.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001309557.1 Gene:brf-1 / 174199 WormBaseID:WBGene00000271 Length:746 Species:Caenorhabditis elegans


Alignment Length:270 Identity:55/270 - (20%)
Similarity:113/270 - (41%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SPLIEDYRAGDMICSECGLVVGDRVIDVGSEWRTFSNEKSGVDPSRVGGPENPLLSGGDLSTIIG 84
            |.:.||...||..|:.||.|:.:.::...::::           .|.||      ||   .|::|
 Worm    11 SEIDEDAARGDATCTACGTVLEESIVVTENQFQ-----------ERAGG------SG---HTLVG 55

  Fly    85 PGTGSASFDAFGAPKYQNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDGKN 149
            ....|   :...|..:....:..|.:.:.....|.|..:..::.:....::.|.|.:|.......
 Worm    56 QFVSS---ERAAANNFNGMGSQESREMTYAKGRKVIDELGSQLRINSHCMNTAFNFYKMCVSRNL 117

  Fly   150 LKGRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKEIGRCFKLTLKALETSVDLITTADFM 214
            .:||:..:..:.|:||.||.|.......:...|::|:..::||......::|..::.......::
 Worm   118 TRGRNRSSVVAVCMYITCRLENTAHLLLDFSDVTQINVFDLGRNLNYLSRSLRINLPSTDPCLYI 182

  Fly   215 CRFCANLDLPNM---VQRAATHIAKKAVEMDIVPGRSPISVAAAAIYMASQASEHKRSQKEIGDI 276
            .||...||..:.   |...||.:.::.....:..||.|..:..||:.:|:::....||..:|..:
 Worm   183 MRFACVLDFGDKQKEVVNLATRLVQRMKRDWMSTGRRPTGICGAALLIAARSLNFNRSINDIVRV 247

  Fly   277 AGVADVTIRQ 286
            ..:::..||:
 Worm   248 VHISEGVIRK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIBNP_001260349.1 SUA7 22..289 CDD:224323 54/268 (20%)
brf-1NP_001309557.1 SUA7 2..261 CDD:224323 55/270 (20%)
BRF1 421..512 CDD:369495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.