DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bug22 and BUG22

DIOPT Version :9

Sequence 1:NP_609402.1 Gene:Bug22 / 34429 FlyBaseID:FBgn0032248 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_566418.1 Gene:BUG22 / 820410 AraportID:AT3G12300 Length:190 Species:Arabidopsis thaliana


Alignment Length:189 Identity:146/189 - (77%)
Similarity:177/189 - (93%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKNTFQSGFLSILYSIGSKPLQLWDKKVRNGHIKRITDNDIQSLVLEIVGTNVSTTFITCPADP 65
            ||||||||||||||||:||||||:|||:|.:||:||..|:||||.|||:||:|:.:|:||||||.
plant     1 MFKNTFQSGFLSILYSLGSKPLQIWDKEVVDGHVKRCHDDDIQSNVLEVVGSNIQSTYITCPADL 65

  Fly    66 KKTLGIKLPFLVMIIKNMKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDEGWN 130
            ..||||||||||:::|:|||||:||:|:||||||||||||||:|:.|||||:|||||:::|||||
plant    66 SATLGIKLPFLVLVVKDMKKYFSFEIQILDDKNVRRRFRASNFQAVTRVKPYICTMPLKMDEGWN 130

  Fly   131 QIQFNLSDFTRRAYGTNYVETLRVQIHANCRIRRVYFSDRLYSEDELPPEFKLFLPIQK 189
            |||.||:|.|||||||||.||||||||||||:||:||:||||||:||||||||:||:||
plant   131 QIQLNLADLTRRAYGTNYAETLRVQIHANCRLRRIYFADRLYSEEELPPEFKLYLPVQK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bug22NP_609402.1 DUF667 1..185 CDD:398611 142/183 (78%)
BUG22NP_566418.1 DUF667 6..185 CDD:282825 137/178 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 317 1.000 Domainoid score I291
eggNOG 1 0.900 - - E1_KOG3213
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7350
Inparanoid 1 1.050 326 1.000 Inparanoid score I691
OMA 1 1.010 - - QHG56333
OrthoDB 1 1.010 - - D1213295at2759
OrthoFinder 1 1.000 - - FOG0005006
OrthoInspector 1 1.000 - - oto4275
orthoMCL 1 0.900 - - OOG6_102689
Panther 1 1.100 - - LDO PTHR12458
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4654
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.