DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bug22 and cfap20

DIOPT Version :9

Sequence 1:NP_609402.1 Gene:Bug22 / 34429 FlyBaseID:FBgn0032248 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001004835.1 Gene:cfap20 / 448101 XenbaseID:XB-GENE-6455885 Length:193 Species:Xenopus tropicalis


Alignment Length:193 Identity:178/193 - (92%)
Similarity:188/193 - (97%) Gaps:0/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKNTFQSGFLSILYSIGSKPLQLWDKKVRNGHIKRITDNDIQSLVLEIVGTNVSTTFITCPADP 65
            |||||||||||||||||||||||:||||||||||||||||||||||||:.|||||||:|||||||
 Frog     1 MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEVEGTNVSTTYITCPADP 65

  Fly    66 KKTLGIKLPFLVMIIKNMKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDEGWN 130
            |||||||||||||||||:|||||||||||||||||||||||||||||||||||||||||||:|||
 Frog    66 KKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWN 130

  Fly   131 QIQFNLSDFTRRAYGTNYVETLRVQIHANCRIRRVYFSDRLYSEDELPPEFKLFLPIQKPVQK 193
            ||||||||||||||||||:|||||||||||||||||||||||||||||.||||:||:|...::
 Frog   131 QIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bug22NP_609402.1 DUF667 1..185 CDD:398611 175/183 (96%)
cfap20NP_001004835.1 DUF667 1..185 CDD:398611 175/183 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 364 1.000 Domainoid score I933
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 372 1.000 Inparanoid score I2071
OMA 1 1.010 - - QHG56333
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005006
OrthoInspector 1 1.000 - - oto104977
Panther 1 1.100 - - LDO PTHR12458
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2463
SonicParanoid 1 1.000 - - X4654
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.