DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bug22 and Cfap20dc

DIOPT Version :9

Sequence 1:NP_609402.1 Gene:Bug22 / 34429 FlyBaseID:FBgn0032248 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_038949382.1 Gene:Cfap20dc / 361016 RGDID:1359720 Length:677 Species:Rattus norvegicus


Alignment Length:171 Identity:44/171 - (25%)
Similarity:80/171 - (46%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKNTFQSG-FLSILYSIGSKPLQLWDKKVRNGHIKRITDNDIQSLVLEIVGTNVSTTFITCPAD 64
            ||||.:|.| |:.|..:.|..|...|........|.:..|.:::|.|..:.|:: .|..|..|.:
  Rat     1 MFKNEYQGGAFVEIFSAQGKNPGAKWKILGSPSVIWKEFDKEVKSFVFVLEGSS-QTNRIQLPKE 64

  Fly    65 PKKTLGIKLPFLVM-IIKNMKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDEG 128
            .|:.||:...|||: |...:.:.|:.|:.:.|..|::||...|.........|....:|:.:.:.
  Rat    65 NKQILGLIQRFLVLQIYVPLGQDFSTELLITDLGNIKRRLYLSTVHKEVSSTPLHAKIPLFMIKR 129

  Fly   129 --WNQIQFNLSDFTRRAY-GTNYVETLRVQIHANCRIRRVY 166
              |..:..:|..||...: |..:.....:.:.|||::|:::
  Rat   130 KIWCNLCIDLVAFTSEIFKGAVFQSLDGIIVSANCKLRKIF 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bug22NP_609402.1 DUF667 1..185 CDD:398611 44/171 (26%)
Cfap20dcXP_038949382.1 DUF667 1..188 CDD:398611 44/171 (26%)
MSCRAMM_ClfB <299..613 CDD:411414
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3213
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.