DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bug22 and CG17118

DIOPT Version :9

Sequence 1:NP_609402.1 Gene:Bug22 / 34429 FlyBaseID:FBgn0032248 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_723611.1 Gene:CG17118 / 34478 FlyBaseID:FBgn0032291 Length:281 Species:Drosophila melanogaster


Alignment Length:193 Identity:117/193 - (60%)
Similarity:153/193 - (79%) Gaps:3/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKNTFQSGFLSILYSIGSKPLQLWDKKVRNGHIKRITDNDIQSLVLEIVGTNVSTTFITCPADP 65
            |::..:|.|||::|||:||.||..|....:||:||||.|.||:||||||:|:|||||||.||::.
  Fly     1 MYRAAYQKGFLTVLYSVGSSPLNNWSSYTKNGYIKRIYDEDIKSLVLEIMGSNVSTTFIHCPSEC 65

  Fly    66 KKTLGIKLPFLVMIIKNMKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDEGWN 130
            |:.|||||||||::||||.|||.|||::.||:...||||.||:||.|.||||...|||.:..|||
  Fly    66 KEQLGIKLPFLVLLIKNMHKYFCFEVKIQDDQRFMRRFRVSNFQSKTSVKPFCTAMPMGMSPGWN 130

  Fly   131 QIQFNLSDFTRRAYGTNYVETLRVQIHANCRIRRVYFSDRLYSEDELPPEFKLF---LPIQKP 190
            ||||||:||||||||:||:||:.:|:|||.||||:||:|:||:|.|||.:::|.   ..::||
  Fly   131 QIQFNLADFTRRAYGSNYLETVSLQLHANVRIRRIYFADKLYTEAELPNDYRLMGKPKDLKKP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bug22NP_609402.1 DUF667 1..185 CDD:398611 115/186 (62%)
CG17118NP_723611.1 DUF667 1..184 CDD:398611 114/182 (63%)
PHA03247 <193..279 CDD:223021 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464308
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3213
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100933at33392
OrthoFinder 1 1.000 - - FOG0005006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12458
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.