DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bug22 and CFAP20

DIOPT Version :9

Sequence 1:NP_609402.1 Gene:Bug22 / 34429 FlyBaseID:FBgn0032248 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_037374.1 Gene:CFAP20 / 29105 HGNCID:29523 Length:193 Species:Homo sapiens


Alignment Length:193 Identity:178/193 - (92%)
Similarity:187/193 - (96%) Gaps:0/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKNTFQSGFLSILYSIGSKPLQLWDKKVRNGHIKRITDNDIQSLVLEIVGTNVSTTFITCPADP 65
            |||||||||||||||||||||||:|||||||||||||||||||||||||.|||||||:|||||||
Human     1 MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADP 65

  Fly    66 KKTLGIKLPFLVMIIKNMKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDEGWN 130
            |||||||||||||||||:|||||||||||||||||||||||||||||||||||||||||||:|||
Human    66 KKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWN 130

  Fly   131 QIQFNLSDFTRRAYGTNYVETLRVQIHANCRIRRVYFSDRLYSEDELPPEFKLFLPIQKPVQK 193
            ||||||.|||||||||||:|||||||||||||||||||||||||||||.||||:||:|...::
Human   131 QIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bug22NP_609402.1 DUF667 1..185 CDD:398611 175/183 (96%)
CFAP20NP_037374.1 DUF667 1..185 CDD:398611 175/183 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156664
Domainoid 1 1.000 362 1.000 Domainoid score I952
eggNOG 1 0.900 - - E1_KOG3213
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7350
Inparanoid 1 1.050 370 1.000 Inparanoid score I2137
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56333
OrthoDB 1 1.010 - - D1213295at2759
OrthoFinder 1 1.000 - - FOG0005006
OrthoInspector 1 1.000 - - oto91196
orthoMCL 1 0.900 - - OOG6_102689
Panther 1 1.100 - - LDO PTHR12458
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2463
SonicParanoid 1 1.000 - - X4654
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.