Sequence 1: | NP_609402.1 | Gene: | Bug22 / 34429 | FlyBaseID: | FBgn0032248 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016878512.1 | Gene: | WDR90 / 197335 | HGNCID: | 26960 | Length: | 1838 | Species: | Homo sapiens |
Alignment Length: | 229 | Identity: | 47/229 - (20%) |
---|---|---|---|
Similarity: | 87/229 - (37%) | Gaps: | 62/229 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 WDKKVRNGHIKRITDNDIQSLVLEIVGTNVSTTFITCPADPKKTLGIKLPFLVMIIKNM-KKYFT 88
Fly 89 FEVQVLDDKNVRRRFRASN----YQSTTRVKPFICTMPMRLDE-----------GWNQIQFNLSD 138
Fly 139 ----FTRRAYGTNYVETLRVQIHANCRIRRVYFSDRLYSE-------DELP-------------- 178
Fly 179 -------------PEFKLFLPIQKPVQKSNAICS 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bug22 | NP_609402.1 | DUF667 | 1..185 | CDD:398611 | 40/213 (19%) |
WDR90 | XP_016878512.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3213 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |