DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bug22 and WDR90

DIOPT Version :9

Sequence 1:NP_609402.1 Gene:Bug22 / 34429 FlyBaseID:FBgn0032248 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_016878512.1 Gene:WDR90 / 197335 HGNCID:26960 Length:1838 Species:Homo sapiens


Alignment Length:229 Identity:47/229 - (20%)
Similarity:87/229 - (37%) Gaps:62/229 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 WDKKVRNGHIKRITDNDIQSLVLEIVGTNVSTTFITCPADPKKTLGIKLPFLVMIIKNM-KKYFT 88
            |.:..:.|.:..:||..::..|..|.|:..:..:|..|....::||:...:|.::.:.: .|:|.
Human    21 WKRSAKQGDVAVVTDKTLKGAVYRIRGSVSAANYIQLPKSSTQSLGLTGRYLYVLFRPLPSKHFV 85

  Fly    89 FEVQVLDDKNVRRRFRASN----YQSTTRVKPFICTMPMRLDE-----------GWNQIQFNLSD 138
            ..:.|....|...|...||    ::||.....|...:..|..:           .|..:|.:|.|
Human    86 IHLDVSSKDNQVIRVSFSNLFKEFKSTATWLQFPLVLEARTPQRDLVGLAPSGARWTCLQLDLQD 150

  Fly   139 ----FTRRAYGTNYVETLRVQIHANCRIRRVYFSDRLYSE-------DELP-------------- 178
                :..|.||  :::::|  :.|:..:|.:|.||..:..       .:||              
Human   151 VLLVYLNRCYG--HLKSIR--LCASLLVRNLYTSDLCFEPAISGAQWAKLPVTPMPREMAFPVPK 211

  Fly   179 -------------PEFKLFLPIQKPVQKSNAICS 199
                         |...|.:| .||::||   ||
Human   212 GESWHDRYIHVRFPSESLKVP-SKPIEKS---CS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bug22NP_609402.1 DUF667 1..185 CDD:398611 40/213 (19%)
WDR90XP_016878512.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3213
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.