DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bug22 and Cfap20

DIOPT Version :9

Sequence 1:NP_609402.1 Gene:Bug22 / 34429 FlyBaseID:FBgn0032248 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_036009655.1 Gene:Cfap20 / 14894 MGIID:107428 Length:280 Species:Mus musculus


Alignment Length:143 Identity:129/143 - (90%)
Similarity:137/143 - (95%) Gaps:1/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GTNVSTTFITCPADPKKTLGIKLPFLVMIIKNMKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVK 115
            ||. |||:||||||||||||||||||||||||:||||||||||||||||||||||||||||||||
Mouse   139 GTK-STTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVK 202

  Fly   116 PFICTMPMRLDEGWNQIQFNLSDFTRRAYGTNYVETLRVQIHANCRIRRVYFSDRLYSEDELPPE 180
            |||||||||||:|||||||||||||||||||||:|||||||||||||||||||||||||||||.|
Mouse   203 PFICTMPMRLDDGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAE 267

  Fly   181 FKLFLPIQKPVQK 193
            |||:||:|...::
Mouse   268 FKLYLPVQNKAKQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bug22NP_609402.1 DUF667 1..185 CDD:398611 126/133 (95%)
Cfap20XP_036009655.1 DUF667 <142..272 CDD:398611 124/129 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847074
Domainoid 1 1.000 364 1.000 Domainoid score I933
eggNOG 1 0.900 - - E1_KOG3213
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7350
Inparanoid 1 1.050 373 1.000 Inparanoid score I2091
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56333
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005006
OrthoInspector 1 1.000 - - oto94779
orthoMCL 1 0.900 - - OOG6_102689
Panther 1 1.100 - - LDO PTHR12458
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2463
SonicParanoid 1 1.000 - - X4654
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.