DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Bug22 and wdr90

DIOPT Version :9

Sequence 1:	NP_609402.1	Gene:	Bug22 / 34429	FlyBaseID:	FBgn0032248	Length:	199	Species:	Drosophila melanogaster
Sequence 2:	NP_001090645.1	Gene:	wdr90 / 100036617	XenbaseID:	XB-GENE-5825492	Length:	1848	Species:	Xenopus tropicalis

Alignment Length:	205	Identity:	47/205 - (22%)
Similarity:	86/205 - (41%)	Gaps:	47/205 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 FQSGFLSILYSIGSKPLQL--WDKKVRNGHIKRITDNDIQSLVLEIVGTNVSTTFITCPADPKKT 68
            :|..|:::.     |.|:|  |.|..:.|.:..:.|..::..|..|.|:..:..:|..|....::
Frog     5 WQHPFVNVF-----KHLRLEEWKKSSKEGDVTSVMDKTLKCTVYRIRGSIPAGNYIQLPKTSSQS 64

  Fly    69 LGIKLPFLVMIIKNMK-KYFTFEVQVL--DDKNVRRRFRASN----YQST-TRVK-PFIC----- 119
            ||:...:|.::.|.:. |:|...:.|.  |.:.||..|  ||    ::|| |.:: ||:|
Frog    65 LGLTGRYLYILFKPLPGKHFVVHIDVSAEDGQTVRISF--SNLFKEFKSTATWLQFPFVCGAIKG 127

  Fly   120 --------------TMPMRLDEGWN----QIQFNLSDFTRRAYGTNYVETLR-VQIHANCRIRRV 165
                          ..|......|.    .:|:.||.:..|.|     ..|| .::.:|..:|.:
Frog   128 SVYDSTAQGARQGMVGPAPSGSRWTCLLLDVQYILSLYLSRRY-----SHLRSAKLCSNLLVRNL 187

  Fly   166 YFSDRLYSED 175
            ..||.|::.:
Frog   188 MTSDLLFNPE 197

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Bug22	NP_609402.1	DUF667	1..185	CDD:398611	47/205 (23%)
wdr90	NP_001090645.1	DUF667	5..195	CDD:282825	47/201 (23%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	257..278
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	316..336
		WD40	<421..570	CDD:295369
		WD40	<424..773	CDD:225201
		WD 1	436..479
		WD40 repeat	441..480	CDD:293791
		WD 2	481..523
		WD40 repeat	486..526	CDD:293791
		WD 3	530..570
		WD40 repeat	531..575	CDD:293791
		WD40 repeat	583..644	CDD:293791
		WD40	633..1026	CDD:225201
		WD 4	644..683
		WD 5	685..724
		WD40	686..1026	CDD:295369
		WD40 repeat	691..727	CDD:293791
		WD 6	727..766
		WD40 repeat	732..768	CDD:293791
		WD 7	769..808
		WD40 repeat	776..810	CDD:293791
		WD 8	811..850
		WD40 repeat	816..857	CDD:293791
		WD40	833..1338	CDD:225201
		WD40 repeat	865..909	CDD:293791
		WD40 repeat	916..941	CDD:293791
		WD 9	955..993
		WD40 repeat	960..997	CDD:293791
		WD 10	998..1035
		WD40 repeat	1003..1038	CDD:293791
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1053..1133
		WD40 repeat	1089..1130	CDD:293791
		WD40 repeat	1138..1180	CDD:293791
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1151..1178
		WD40 repeat	1219..1252	CDD:293791
		WD40	1248..1612	CDD:295369
		WD 11	1252..1297
		WD40 repeat	1258..1300	CDD:293791
		WD 12	1300..1341
		WD40 repeat	1305..1346	CDD:293791
		WD 13	1343..1382
		WD40 repeat	1349..1395	CDD:293791
		WD 14	1395..1433
		WD 15	1435..1473
		WD40	1448..1848	CDD:225201
		WD40 repeat	1496..1532	CDD:293791
		WD40	1526..1844	CDD:295369
		WD 16	1532..1571
		WD40 repeat	1537..1573	CDD:293791
		WD 17	1574..1621
		WD40 repeat	1580..1622	CDD:293791
		WD 18	1624..1663
		WD40 repeat	1629..1665	CDD:293791
		WD 19	1670..1714
		WD40 repeat	1672..1720	CDD:293791
		WD 20	1774..1813
		WD40 repeat	1779..1812	CDD:293791
		WD 21	1815..1848
		WD40 repeat	1820..1845	CDD:293791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910