DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5188 and MAP1

DIOPT Version :9

Sequence 1:NP_609401.2 Gene:CG5188 / 34428 FlyBaseID:FBgn0032247 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_013345.1 Gene:MAP1 / 850945 SGDID:S000004234 Length:387 Species:Saccharomyces cerevisiae


Alignment Length:297 Identity:117/297 - (39%)
Similarity:171/297 - (57%) Gaps:16/297 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GKVKGDTGKYEQIVSTGQVSPERFVPEEIKKPAYYFKNMP----PGNTLGSPEIKSQVQIDAMRL 84
            ||||          ::..::|.|:|||:|.||.:....:|    ..:.|.:..|..:.||..:|.
Yeast    86 GKVK----------ASYPLTPRRYVPEDIPKPDWAANGLPVSEQRNDRLNNIPIYKKDQIKKIRK 140

  Fly    85 SGRLAARILRECGKLATVGTTTDQIDAFAHERILESKAYPSPLRYAGFPKSICTSINNIACHGIP 149
            :..|...:|.........|.|||::|...|...::..||||||.|..||||:|||:|.:.|||:|
Yeast   141 ACMLGREVLDIAAAHVRPGITTDELDEIVHNETIKRGAYPSPLNYYNFPKSLCTSVNEVICHGVP 205

  Fly   150 DDRQLADGDIINIDVTVFLNGYHGDCSETFRVG-NVDERGGFLVEATKSCLDQCISLCGPGVEFN 213
            |...|.:|||:|:||:::..|||.|.:||:.|| |:.:......|.::.||...|.:|.||..|.
Yeast   206 DKTVLKEGDIVNLDVSLYYQGYHADLNETYYVGENISKEALNTTETSRECLKLAIKMCKPGTTFQ 270

  Fly   214 EIGKFIDRYCDEHDLASIAAFIGHGIGSYFHGPPEILHY-YNEIPGKMQPGMTFTIEPILSLGGA 277
            |:|..|:::..|:..:.:..:.|||:|.:||..|.|.|| .|..||.|:|||.|||||:::.|..
Yeast   271 ELGDHIEKHATENKCSVVRTYCGHGVGEFFHCSPNIPHYAKNRTPGVMKPGMVFTIEPMINEGTW 335

  Fly   278 EIAVLQDGWTAISLDGARSAQFEHTILITETGTEILT 314
            :.....|.||:.:.||..|||||||:|:||.|.||||
Yeast   336 KDMTWPDDWTSTTQDGKLSAQFEHTLLVTEHGVEILT 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5188NP_609401.2 MetAP1 79..315 CDD:238519 101/238 (42%)
MAP1NP_013345.1 PLN03158 23..379 CDD:215607 117/297 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.