DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5188 and MAP1B

DIOPT Version :9

Sequence 1:NP_609401.2 Gene:CG5188 / 34428 FlyBaseID:FBgn0032247 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_189202.1 Gene:MAP1B / 822165 AraportID:AT3G25740 Length:344 Species:Arabidopsis thaliana


Alignment Length:314 Identity:139/314 - (44%)
Similarity:182/314 - (57%) Gaps:32/314 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GKVKGDT---GKYEQIVST-----------GQVSPERFVPEEIKKPAYYFKNMPPGNTLGSPEIK 74
            ||.|..:   .:.:|:.||           |.|||...||:.|.||.|.       .:...|||.
plant    37 GKKKSSSLRIKRIQQLQSTLEDRINPPLVCGTVSPRLSVPDHILKPLYV-------ESSKVPEIS 94

  Fly    75 SQVQID------AMRLSGRLAARILRECGKLATVGTTTDQIDAFAHERILESKAYPSPLRYAGFP 133
            |::||.      .|:.:..||||:|...|.|.....|||:||...|:.::|..||||||.|.|||
plant    95 SELQIPDSIGIVKMKKACELAARVLDYAGTLVRPFVTTDEIDKAVHQMVIEFGAYPSPLGYGGFP 159

  Fly   134 KSICTSINNIACHGIPDDRQLADGDIINIDVTVFLNGYHGDCSETFRVGNVDERGGFLVEATKSC 198
            ||:|||:|....|||||.|.|.:||||||||.|:|:|||||.|:||..|:|:.....||:.|:.|
plant   160 KSVCTSVNECMFHGIPDSRPLQNGDIINIDVAVYLDGYHGDTSKTFLCGDVNGSLKQLVKVTEEC 224

  Fly   199 LDQCISLCGPGVEFNEIGKFIDRYCDEHDLASIAAFIGHGIGSYFHGPPEI-LH--YYNEIPGKM 260
            |::.||:|..|..|.:|||.|..:..::.. ::..|||||:|:..|..|.| ||  |..|:. .|
plant   225 LEKGISVCKDGASFKQIGKIISEHAAKYGY-NMERFIGHGVGTVLHSEPLIYLHSNYDYELE-YM 287

  Fly   261 QPGMTFTIEPILSLGGAEIAVLQDGWTAISLDGARSAQFEHTILITETGTEILT 314
            ..|.|||:||||::|..|.....|.||.::.||..:||||||||||.||.||||
plant   288 IEGQTFTLEPILTIGTTEFVTWPDKWTIVTADGGPAAQFEHTILITTTGAEILT 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5188NP_609401.2 MetAP1 79..315 CDD:238519 118/245 (48%)
MAP1BNP_189202.1 MetAP1 105..341 CDD:238519 115/237 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 265 1.000 Domainoid score I460
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I809
OMA 1 1.010 - - QHG54721
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 1 1.000 - - FOG0005461
OrthoInspector 1 1.000 - - otm2437
orthoMCL 1 0.900 - - OOG6_100342
Panther 1 1.100 - - O PTHR43330
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3885
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.