DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5188 and Metap1

DIOPT Version :9

Sequence 1:NP_609401.2 Gene:CG5188 / 34428 FlyBaseID:FBgn0032247 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_780433.1 Gene:Metap1 / 75624 MGIID:1922874 Length:386 Species:Mus musculus


Alignment Length:327 Identity:135/327 - (41%)
Similarity:187/327 - (57%) Gaps:20/327 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLNSLMRQKTTARNLFQFGKVKGD--TGKYEQIVSTGQVSPE------RFVPEEIKKPAYYFKNM 62
            ||:...:.:...|.:..: .|:||  |..:.....||::.|.      |.||..|::|.|  .:.
Mouse    50 LLHKKAKDEKAKREVCSW-TVEGDVNTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDY--ADH 111

  Fly    63 PPGNT------LGSPEIK--SQVQIDAMRLSGRLAARILRECGKLATVGTTTDQIDAFAHERILE 119
            |.|.:      .|:.:||  |...|:.|||..|||..:|.....:...|.||::||...|...:.
Mouse   112 PLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDIAAGMIKAGVTTEEIDHAVHLACIA 176

  Fly   120 SKAYPSPLRYAGFPKSICTSINNIACHGIPDDRQLADGDIINIDVTVFLNGYHGDCSETFRVGNV 184
            ...|||||.|..||||.|||:|.:.||||||.|.|.:|||:|:|:|::.||||||.:|||.||:|
Mouse   177 RNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGDV 241

  Fly   185 DERGGFLVEATKSCLDQCISLCGPGVEFNEIGKFIDRYCDEHDLASIAAFIGHGIGSYFHGPPEI 249
            ||....||:.|..||.|.|....|||.:.|:|..|.::...:..:.:.::.||||...||..|.:
Mouse   242 DEGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNV 306

  Fly   250 LHY-YNEIPGKMQPGMTFTIEPILSLGGAEIAVLQDGWTAISLDGARSAQFEHTILITETGTEIL 313
            .|| .|:..|.|:.|..|||||::..||.:.....|||||::.||.||||||||:|:|:||.|||
Mouse   307 PHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEIL 371

  Fly   314 TR 315
            ||
Mouse   372 TR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5188NP_609401.2 MetAP1 79..315 CDD:238519 111/236 (47%)
Metap1NP_780433.1 Zinc finger-like, important for proper ribosome association. /evidence=ECO:0000255|HAMAP-Rule:MF_03174 9..52 1/1 (100%)
APP_MetAP 14..382 CDD:320876 135/327 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.