DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5188 and CG13630

DIOPT Version :9

Sequence 1:NP_609401.2 Gene:CG5188 / 34428 FlyBaseID:FBgn0032247 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_651281.1 Gene:CG13630 / 42943 FlyBaseID:FBgn0039219 Length:374 Species:Drosophila melanogaster


Alignment Length:303 Identity:130/303 - (42%)
Similarity:173/303 - (57%) Gaps:20/303 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FQFGKVKGDTGKYEQIVSTGQVSPERFVPEEIKKPAYYFKNMPPGNTLGSPEIK-------SQVQ 78
            |:|      |||......|    |:|.||..|::|.|  .:.|.|.:|....::       ...:
  Fly    70 FRF------TGKLRPFPQT----PKRTVPNAIQRPDY--ADHPAGRSLSEEALRGTKIKVLDDEE 122

  Fly    79 IDAMRLSGRLAARILRECGKLATVGTTTDQIDAFAHERILESKAYPSPLRYAGFPKSICTSINNI 143
            |:.||::|||....|.|..|...||.|||::|...||..:|.:.|||||.|..||||.|||:|.:
  Fly   123 IEGMRVAGRLGRECLDEGAKAVEVGITTDELDRLVHEAAIERECYPSPLNYYNFPKSCCTSVNEV 187

  Fly   144 ACHGIPDDRQLADGDIINIDVTVFLNGYHGDCSETFRVGNVDERGGFLVEATKSCLDQCISLCGP 208
            .||||||.|.|.|||:.||||||:..|:|||.:|||.||||.|:...||:.|...|.:.|....|
  Fly   188 ICHGIPDQRPLQDGDLCNIDVTVYHRGFHGDLNETFFVGNVSEKHKKLVQVTHEALSKAIEFVRP 252

  Fly   209 GVEFNEIGKFIDRYCDEHDLASIAAFIGHGIGSYFHGPPEILHY-YNEIPGKMQPGMTFTIEPIL 272
            |.::.:||..|.:|...|..:.:.::.||||...||..|.:.|| .|...|.|.||..|||||::
  Fly   253 GEKYRDIGNVIQKYVAPHGFSVVRSYCGHGIHRVFHTAPNVPHYAKNSAVGVMAPGHCFTIEPMI 317

  Fly   273 SLGGAEIAVLQDGWTAISLDGARSAQFEHTILITETGTEILTR 315
            |:|..:.....|.|||::.||..|||||.|:|:.|||.||||:
  Fly   318 SVGVQKAETWPDDWTAVTADGLYSAQFEQTLLVNETGCEILTK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5188NP_609401.2 MetAP1 79..315 CDD:238519 113/236 (48%)
CG13630NP_651281.1 zf-C6H2 9..48 CDD:292429
PLN03158 10..369 CDD:215607 130/303 (43%)
MetAP1 123..360 CDD:238519 113/236 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456475
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51428
orthoMCL 1 0.900 - - OOG6_100342
Panther 1 1.100 - - P PTHR43330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.