DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5188 and fma1

DIOPT Version :9

Sequence 1:NP_609401.2 Gene:CG5188 / 34428 FlyBaseID:FBgn0032247 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_596097.1 Gene:fma1 / 2540928 PomBaseID:SPBC3E7.10 Length:379 Species:Schizosaccharomyces pombe


Alignment Length:284 Identity:121/284 - (42%)
Similarity:166/284 - (58%) Gaps:11/284 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VSPERFVPEEIKKPAYYFKNMPPGNTLGSPEIK----SQVQIDAMRLSGRLAARILRECGKLATV 102
            :||.|.||..||:|.|....:.....:.....|    :..:.:.||...||...:|.........
pombe    84 LSPIRKVPPHIKRPDYAKTGVSRSEQIEGRSFKLKRLTPKEQEGMRKVCRLGREVLDAAAAAVRP 148

  Fly   103 GTTTDQIDAFAHERILESKAYPSPLRYAGFPKSICTSINNIACHGIPDDRQLADGDIINIDVTVF 167
            |||||::|:..|...:|...:||.|.|..||||:|||:|.|.||||||.|.|.||||:||||:::
pombe   149 GTTTDELDSIVHNACIERDCFPSTLNYYAFPKSVCTSVNEIICHGIPDQRPLEDGDIVNIDVSLY 213

  Fly   168 LNGYHGDCSETFRVGNVDERGG---FLVEATKSCLDQCISLCGPGVEFNEIGKFIDRYCD---EH 226
            .||:|||.:||:.||:..:...   .|||.|:..||:.|:...|||.|.|.|..|:::.:   |.
pombe   214 HNGFHGDLNETYYVGDKAKANPDLVCLVENTRIALDKAIAAVKPGVLFQEFGNIIEKHTNSITEK 278

  Fly   227 DLASIAAFIGHGIGSYFHGPPEILHY-YNEIPGKMQPGMTFTIEPILSLGGAEIAVLQDGWTAIS 290
            .::.:..:.||||...||..|.|.|| :|:.||..:|||||||||:|:||.|......|.||:.:
pombe   279 QISVVRTYCGHGINQLFHCSPSIPHYSHNKAPGIARPGMTFTIEPMLTLGPARDITWPDDWTSST 343

  Fly   291 LDGARSAQFEHTILITETGTEILT 314
            ..|..|||||||:|:||||.|:||
pombe   344 ASGRCSAQFEHTLLVTETGCEVLT 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5188NP_609401.2 MetAP1 79..315 CDD:238519 111/243 (46%)
fma1NP_596097.1 PLN03158 1..374 CDD:215607 121/284 (43%)
zf-C6H2 14..53 CDD:292429
MetAP1 126..367 CDD:238519 109/240 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.