DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5188 and METAP1

DIOPT Version :9

Sequence 1:NP_609401.2 Gene:CG5188 / 34428 FlyBaseID:FBgn0032247 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_055958.2 Gene:METAP1 / 23173 HGNCID:15789 Length:386 Species:Homo sapiens


Alignment Length:327 Identity:134/327 - (40%)
Similarity:186/327 - (56%) Gaps:20/327 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLNSLMRQKTTARNLFQFGKVKGD--TGKYEQIVSTGQVSPE------RFVPEEIKKPAYYFKNM 62
            ||:...:.:...|.:..: .|:||  |..:.....||::.|.      |.||..|::|.|  .:.
Human    50 LLHKKAKDEKAKREVSSW-TVEGDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDY--ADH 111

  Fly    63 PPGNT------LGSPEIK--SQVQIDAMRLSGRLAARILRECGKLATVGTTTDQIDAFAHERILE 119
            |.|.:      .|:.:||  |...|:.|||..|||..:|.....:...|.||::||...|...:.
Human   112 PLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIA 176

  Fly   120 SKAYPSPLRYAGFPKSICTSINNIACHGIPDDRQLADGDIINIDVTVFLNGYHGDCSETFRVGNV 184
            ...|||||.|..||||.|||:|.:.||||||.|.|.:|||:|:|:|::.||||||.:|||.||.|
Human   177 RNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEV 241

  Fly   185 DERGGFLVEATKSCLDQCISLCGPGVEFNEIGKFIDRYCDEHDLASIAAFIGHGIGSYFHGPPEI 249
            |:....||:.|..||.|.|....|||.:.|:|..|.::...:..:.:.::.||||...||..|.:
Human   242 DDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNV 306

  Fly   250 LHY-YNEIPGKMQPGMTFTIEPILSLGGAEIAVLQDGWTAISLDGARSAQFEHTILITETGTEIL 313
            .|| .|:..|.|:.|..|||||::..||.:.....|||||::.||.||||||||:|:|:||.|||
Human   307 PHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEIL 371

  Fly   314 TR 315
            ||
Human   372 TR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5188NP_609401.2 MetAP1 79..315 CDD:238519 110/236 (47%)
METAP1NP_055958.2 Zinc finger-like, important for proper ribosome association. /evidence=ECO:0000255|HAMAP-Rule:MF_03174 9..52 1/1 (100%)
zf-C6H2 12..53 CDD:292429 2/2 (100%)
PLN03158 14..382 CDD:215607 134/327 (41%)
MetAP1 136..373 CDD:238519 110/236 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.